DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12581 and faima

DIOPT Version :9

Sequence 1:NP_649435.2 Gene:CG12581 / 40522 FlyBaseID:FBgn0037213 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001002583.1 Gene:faima / 436856 ZFINID:ZDB-GENE-040718-323 Length:179 Species:Danio rerio


Alignment Length:40 Identity:11/40 - (27%)
Similarity:15/40 - (37%) Gaps:7/40 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RSLYPSEGAVGAKGID-------SWLSVWSNGILLENVDE 67
            ||...|...:...|||       ..:.:|.||..:|...|
Zfish    94 RSKVTSTWLLNLDGIDCRVVLEKDTMDIWCNGQKMETAGE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12581NP_649435.2 PTB_CG12581 3..168 CDD:241252 11/40 (28%)
faimaNP_001002583.1 FAIM1 4..175 CDD:284354 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.