powered by:
Protein Alignment CG12581 and faima
DIOPT Version :9
Sequence 1: | NP_649435.2 |
Gene: | CG12581 / 40522 |
FlyBaseID: | FBgn0037213 |
Length: | 665 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002583.1 |
Gene: | faima / 436856 |
ZFINID: | ZDB-GENE-040718-323 |
Length: | 179 |
Species: | Danio rerio |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 15/40 - (37%) |
Gaps: | 7/40 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 RSLYPSEGAVGAKGID-------SWLSVWSNGILLENVDE 67
||...|...:...||| ..:.:|.||..:|...|
Zfish 94 RSKVTSTWLLNLDGIDCRVVLEKDTMDIWCNGQKMETAGE 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4352 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.