DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and HTR3B

DIOPT Version :9

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_006019.1 Gene:HTR3B / 9177 HGNCID:5298 Length:441 Species:Homo sapiens


Alignment Length:325 Identity:85/325 - (26%)
Similarity:146/325 - (44%) Gaps:47/325 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NPDAKRLY---DDLLSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYD 70
            :|....||   ..||..|:|.||||.|.|....|.:.|.:..::||:.:|||:.|::|.::.|.|
Human    26 HPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWND 90

  Fly    71 YKLRWEPKEYGGVHMLHVPSDHIWRPDIVL---------------YNNADGNFEVTLATKATIYS 120
            ..|.|....:..:..:.:|...||.|||::               |.|:.|..|           
Human    91 EFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIE----------- 144

  Fly   121 EGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLS 185
                .:||..:. |:|.::...||||.|.|.|.|.|..:....|||..:...:.     :..|..
Human   145 ----NYKPIQVV-SACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPED-----IQHDKK 199

  Fly   186 EFYMSVEWDILEVPAVRNEKFYTCCDEP---YLDITFNITMRRKTLFYTVNIIIPCMGISFLTVL 247
            .|....||::|.|.:.     |:.....   :..|.||:.|||..|.|.|:::||.:.:..:.:.
Human   200 AFLNDSEWELLSVSST-----YSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLG 259

  Fly   248 TFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVL 312
            :||||.:...::....|:|:...||.:.:...:|.:....||:|.:....|..:.:|:..::|::
Human   260 SFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLV 324

  Fly   313  312
            Human   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 85/325 (26%)
Neur_chan_LBD 12..227 CDD:280998 64/235 (27%)
Neur_chan_memb 234..505 CDD:280999 17/79 (22%)
HTR3BNP_006019.1 LIC 8..435 CDD:273305 85/325 (26%)
Neur_chan_LBD 33..239 CDD:280998 63/231 (27%)
Neur_chan_memb 246..>328 CDD:280999 17/79 (22%)
HA-stretch 381..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.