DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and Htr3b

DIOPT Version :9

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_071525.1 Gene:Htr3b / 58963 RGDID:61820 Length:437 Species:Rattus norvegicus


Alignment Length:319 Identity:81/319 - (25%)
Similarity:150/319 - (47%) Gaps:8/319 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GNPDAKRLYDDLLSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYK 72
            ||....||...||..|:|.||||.|..:...|.:.|.:..::||:::||.:.|::|..:.|.|..
  Rat    24 GNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAVLDVDVQNQKLKTSMWYREVWNDEF 88

  Fly    73 LRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCE 137
            |.|....:..:..:.:|...||.|||::....|......| ....:.|.|.:....|....|:|.
  Rat    89 LSWNSSLFDDIQEISLPLSAIWAPDIIINEFVDVERSPDL-PYVYVNSSGTIRNHKPIQVVSACS 152

  Fly   138 IDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVR 202
            :....||||.|.|.|.|.|..:....:||..:..|:.     :..|...|....||.:|.|.:..
  Rat   153 LQTYAFPFDIQNCSLTFNSILHTVEDIDLGFLRNQED-----IENDKRSFLNDSEWQLLSVTSTY 212

  Fly   203 NEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILI 267
            :.:..:..|  :..|.||:.:||..|.|.|:::||.:.:..:.:.:||||.:...::....::|:
  Rat   213 HIRQSSAGD--FAQIRFNVVIRRCPLAYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLV 275

  Fly   268 SLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAP 326
            ...||.:.:.:.:|.::....|:|.:....|.|:.:|:..:::::...:....:.:..|
  Rat   276 GYTVFRVNMSDEVPRSAGCTSLIGVFFTVCMALLVLSLSKSILLIKFLYEERHSEQERP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 81/319 (25%)
Neur_chan_LBD 12..227 CDD:280998 60/214 (28%)
Neur_chan_memb 234..505 CDD:280999 16/93 (17%)
Htr3bNP_071525.1 LIC 30..431 CDD:273305 79/313 (25%)
Neur_chan_LBD 30..233 CDD:280998 58/210 (28%)
Neur_chan_memb 242..>313 CDD:280999 14/70 (20%)
HA-stretch 377..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.