DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and CHRNA9

DIOPT Version :9

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_060051.2 Gene:CHRNA9 / 55584 HGNCID:14079 Length:479 Species:Homo sapiens


Alignment Length:508 Identity:191/508 - (37%)
Similarity:284/508 - (55%) Gaps:70/508 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AKRLYDDLLSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWE 76
            |::|::||..:|:..:|||.:|..||.|.:::.|||:.|::.:|||:|..||:.|.|:|..|.|:
Human    31 AQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWD 95

  Fly    77 PKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVE 141
            ..:|.|:..:.:|||.:|||||||||.||......:.|...:..:||:.|..|||.||||.:||.
Human    96 RDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVT 160

  Fly   142 YFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKF 206
            |||||.|.|.|.||||||:|.:||:        .|.:..| |||:|...|||::..:|||:|...
Human   161 YFPFDNQQCNLTFGSWTYNGNQVDI--------FNALDSG-DLSDFIEDVEWEVHGMPAVKNVIS 216

  Fly   207 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHV 271
            |.||.|||.|:||.:.::|::.||.||::|||:.||||..|:||||:.|||||:|.::||:::.|
Human   217 YGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTV 281

  Fly   272 FFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFL 336
            |.|:|.||: |.|..|||:|||.|..|.|::.|..:|::|:|:||...:...:..|.:.|.:.::
Human   282 FQLMVAEIM-PASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYM 345

  Fly   337 PAFLFIKRPTYNFETSKLLLKDTHACFYPYYSATNIDRLVSSGYNNSLPK--------EDLSQSI 393
            ...||:    |:...|         |..|::|... |.|..  ..:.||:        :|||:..
Human   346 SRVLFV----YDVGES---------CLSPHHSRER-DHLTK--VYSKLPESNLKAARNKDLSRKK 394

  Fly   394 TANGPFGG--SCQVHGPVPPLTHCSSDEIAAVPDMDIGPLGMKSPILNNPAFSHSKCLPKIHKSC 456
            ..|.....  .||...|....::|:..::                :..|..:. :||| |.||  
Human   395 DMNKRLKNDLGCQGKNPQEAESYCAQYKV----------------LTRNIEYI-AKCL-KDHK-- 439

  Fly   457 FCVRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQA 509
                  |.::|..|        ||.||.|:||.|:|||.:.|.|.|..||.:|
Human   440 ------ATNSKGSE--------WKKVAKVIDRFFMWIFFIMVFVMTILIIARA 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 188/502 (37%)
Neur_chan_LBD 12..227 CDD:280998 96/214 (45%)
Neur_chan_memb 234..505 CDD:280999 88/280 (31%)
CHRNA9NP_060051.2 LIC 10..474 CDD:273305 188/502 (37%)
Neur_chan_LBD 31..236 CDD:280998 95/213 (45%)
Neur_chan_memb 244..474 CDD:280999 88/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4952
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.