DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and Rdl

DIOPT Version :9

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001261617.1 Gene:Rdl / 39054 FlyBaseID:FBgn0004244 Length:608 Species:Drosophila melanogaster


Alignment Length:325 Identity:74/325 - (22%)
Similarity:131/325 - (40%) Gaps:43/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GAVAGNPDAKRLYDDLLSNYNKLVRPVVN--TTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQ 66
            |::.|:.:...:.|....:|:|.|||...  ..:|......|.:|.|.:|.:.   .|.:.:..|
  Fly    51 GSMLGDVNISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMD---FTLDFYFRQ 112

  Fly    67 SWYDYKLRWEPKEYGGVHMLHVPSD---HIWRPDIVLYNNADGNFEVTLATK--ATIYSEGLVEW 126
            .|.|.:|.:..:.  ||..|.|.|:   :||.||....|.....|.:...:.  ..::..|.:..
  Fly   113 FWTDPRLAYRKRP--GVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITR 175

  Fly   127 KPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSV 191
            .......:||.::::|||.|.|.|.::..|:.|.  ..|:|:....          .||...||.
  Fly   176 SIRLTITASCPMNLQYFPMDRQLCHIEIESFGYT--MRDIRYFWRD----------GLSSVGMSS 228

  Fly   192 EWDILEVPAVR--------NEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLT 248
            |   :|:|..|        .|...|..:  |..:...|...|...:|.:.|.||...|..::.::
  Fly   229 E---VELPQFRVLGHRQRATEINLTTGN--YSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVS 288

  Fly   249 FYLPSD-SGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPL---LGKYLIFAMILVSISICVTV 309
            |:|..: :..:|.|.::.::::..........:|..|.|..:   ||  ..|.|:..|:....||
  Fly   289 FWLNRNATPARVALGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLG--TCFVMVFASLLEYATV 351

  Fly   310  309
              Fly   352  351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 74/325 (23%)
Neur_chan_LBD 12..227 CDD:280998 53/229 (23%)
Neur_chan_memb 234..505 CDD:280999 18/80 (23%)
RdlNP_001261617.1 LGIC_ECD_GABAR_RDL-like 83..266 CDD:349809 46/204 (23%)
Neur_chan_memb 274..588 CDD:397193 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.