DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and acr-14

DIOPT Version :10

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_495716.1 Gene:acr-14 / 191601 WormBaseID:WBGene00000053 Length:500 Species:Caenorhabditis elegans


Alignment Length:30 Identity:9/30 - (30%)
Similarity:14/30 - (46%) Gaps:4/30 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SYHIIKNGD----HLHSYTAEEIELIAMLV 211
            |:|.|...|    :.....|:.::.|.|||
 Worm    55 SFHFISTNDPYAMNFRFVAADTLQKIIMLV 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:455710 9/30 (30%)
LGIC_ECD_nAChR_proto_alpha-like 11..229 CDD:349832 9/30 (30%)
Cys-loop 136..150 CDD:349832
acr-14NP_495716.1 Neur_chan_LBD 21..258 CDD:460752 9/30 (30%)
Neur_chan_memb 265..491 CDD:460753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.