DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and lgc-18

DIOPT Version :9

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_510029.3 Gene:lgc-18 / 187977 WormBaseID:WBGene00011360 Length:399 Species:Caenorhabditis elegans


Alignment Length:336 Identity:72/336 - (21%)
Similarity:149/336 - (44%) Gaps:61/336 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLYDDLLSNYNKLVRPVVNTTDV-------------LKVCIKLKLSQLIDVNLKNQIMTTNLWVE 65
            :|..|:.:||:..:.||....|.             ....:.|...:|::|....:.::..|.:.
 Worm    36 KLIKDVFTNYDNTLSPVYTKIDPTQPIGYNPLAPKRFNYTVSLYYLKLVEVIEPEEKVSVVLEMA 100

  Fly    66 QSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNAD-----------------GNFEVTLA 113
            :.|||.::.|:...||.:.|||:..|.:|.|.:.|:...|                 |:...||:
 Worm   101 EYWYDPRIAWDSSLYGDIKMLHMRQDKVWSPTLSLFRINDIADFRDPDFRMVCVENTGHTYTTLS 165

  Fly   114 TKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVV 178
            .|.::                :|.:||..||:|.|||.::        |.:.|..|.:.:..:.:
 Worm   166 VKISL----------------NCPLDVSMFPYDSQTCRIQ--------FNMPLFFMQQVEMFSQI 206

  Fly   179 AVGVDLSEFYMSV---EWDILEVP-AVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCM 239
            ..|:..|..:..:   ||::..:. :|....:.....:..| .||.|.:||..::|...||.|..
 Worm   207 YEGILNSTVWEKMGNSEWELANLTHSVELLSYGDGLGDMQL-ATFEIRIRRNPMYYIYMIIFPSF 270

  Fly   240 GISFLTVLTFYL-PSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSI 303
            .|:.|:::..:| .:|...|:.:.::.::::.....::.:.||.|. .:||||.|:|..:.::.:
 Worm   271 IINALSIIGVFLKKTDKMSKLNVGLTNIMTMTFILGVMADKIPKTG-SIPLLGIYIIVNLFIMIV 334

  Fly   304 SICVTVVVLNV 314
            ::.:|:|:..:
 Worm   335 AVGLTIVLAEI 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 72/336 (21%)
Neur_chan_LBD 12..227 CDD:280998 52/246 (21%)
Neur_chan_memb 234..505 CDD:280999 19/82 (23%)
lgc-18NP_510029.3 LGIC_ECD_cation 75..257 CDD:349790 44/206 (21%)
LGIC_TM_cation 259..>341 CDD:349853 19/82 (23%)
TM1 helix 263..284 CDD:349853 6/20 (30%)
TM2 helix 292..313 CDD:349853 0/20 (0%)
TM3 helix 323..341 CDD:349853 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.