DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha4 and HTR3C

DIOPT Version :9

Sequence 1:NP_001097669.2 Gene:nAChRalpha4 / 40521 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_570126.2 Gene:HTR3C / 170572 HGNCID:24003 Length:447 Species:Homo sapiens


Alignment Length:314 Identity:87/314 - (27%)
Similarity:160/314 - (50%) Gaps:18/314 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVP 89
            |..||..|.:...:|.|...||.::.|:.:.|::|:.||::..|.:..:.|.|||..|::.|.|.
Human    52 KAFRPFTNYSIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVL 116

  Fly    90 SDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKF 154
            ::::|.|||.:..:.|.: :......|.|.|||.:::..|....|.|.:|:.|||||:|.|...|
Human   117 AENLWLPDIFIVESMDVD-QTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF 180

  Fly   155 GSWTYDGFKVD--LRHMDEQQGSNVVAVGVDLSEFYMSV--EWDILEVPAVRNEKFYTCCDEPYL 215
            .|:.|   .||  |..||::     |....|.|...:..  ||::|.:.....:  .:..:..|.
Human   181 SSFLY---TVDSMLLGMDKE-----VWEITDTSRKVIQTQGEWELLGINKATPK--MSMGNNLYD 235

  Fly   216 DITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEII 280
            .|.|.:.:||:...|.:|:::|...:..:..|:||||::|..:....|::|:..:||.|::.:::
Human   236 QIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLL 300

  Fly   281 PPTSLVVPLLGKYLIFAMILVSISICVTV-VVLNVHFRSPQTHKMAPWVKRVFI 333
            |.:.  .||:..|....:.|:.:|:..|| :...:|..:.|...|..|:..:.:
Human   301 PASG--TPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 87/314 (28%)
Neur_chan_LBD 12..227 CDD:280998 61/205 (30%)
Neur_chan_memb 234..505 CDD:280999 24/101 (24%)
HTR3CNP_570126.2 Neur_chan_LBD 43..445 CDD:332142 87/314 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..405
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.