DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Hepacam

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_780398.2 Gene:Hepacam / 72927 MGIID:1920177 Length:418 Species:Mus musculus


Alignment Length:304 Identity:71/304 - (23%)
Similarity:115/304 - (37%) Gaps:77/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 LVHYEPGPAAL---------SHFPLV---AVKKKSVTFSCSVDD-------PGFPESNRFRWLRG 620
            |:|...|.:||         |..|:|   ..:.|.||...|:..       |.:  .:|.|....
Mouse    42 LIHGTVGKSALLSVQYSSTSSDKPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDY--RDRIRLFEN 104

  Fly   621 GRGPLQDIVTKD---WTVE-PVGLDSRTNYSCYAYNEGGKGVMATVNLEVHAPPFFIKNLPPYTG 681
            |...|.|:...|   :.|| .:..|:.|         |.|.:..||::.:..|...:.:    |.
Mouse   105 GSLLLSDLQLADEGTYEVEISITDDTFT---------GEKTINLTVDVPISRPQVLVAS----TT 156

  Fly   682 ILHSSPNATLTCRIECVPRCDISWQKDGVPIERNDSRYFIK--EKYMDASPATGDFESMLSVLHF 744
            :|..|...||.|..|...:...:|.|||.|: .||||..:.  :|.:..:....:.:.:.|.:..
Mouse   157 VLELSEAFTLNCSHENGTKPSYTWLKDGKPL-LNDSRMLLSPDQKVLTITRVLMEDDDLYSCVVE 220

  Fly   745 NMPNWPDS-------KFNIEADNANYSCVSTGNIV------------GGSIRSR------TYFGI 784
            |    |.|       |..:...::.|..:|||.|.            ..|.:||      ....:
Mouse   221 N----PISQVRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKKSRKKRKLEKQNSL 281

  Fly   785 EYAPENTTVSENIVYVQEDTIPGRVICKSRANPEPSYKWIFKNE 828
            ||..:|    ::.:..:.||:| |...:.|.||...|  |.|::
Mouse   282 EYMDQN----DDRLKSEADTLP-RSGEQERKNPMALY--ILKDK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845
IG_like 383..463 CDD:214653
Ig 394..463 CDD:143165
Ig_3 585..652 CDD:290638 19/89 (21%)
Ig 685..>719 CDD:299845 13/33 (39%)
IG_like 788..869 CDD:214653 11/41 (27%)
Ig <811..869 CDD:299845 6/18 (33%)
HepacamNP_780398.2 V-set 41..141 CDD:311561 25/109 (23%)
Ig 164..228 CDD:319273 18/68 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..418 13/55 (24%)
GlyL_C <324..383 CDD:331170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.