DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Kirrel3

DIOPT Version :10

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_001420714.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:1101 Identity:212/1101 - (19%)
Similarity:333/1101 - (30%) Gaps:461/1101 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 VQGSKVVLTCDI-----------HGARPAV--NLTWYNTTTIIS---SGENEITEVRSKSLEKSD 326
            |.|..|.|.|.|           .|....|  :|:.|....::.   |||:.:..:|::      
Mouse    60 VSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAE------ 118

  Fly   327 GTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALTLEVLYP---PVVKVSPSAITA 388
                           .::|.|:.|:|....:   |.:|    ..|.||.|   |::...| .|:.
Mouse   119 ---------------LQDDAVYECQAIQAAI---RSRP----ARLTVLVPPDDPIILGGP-VISL 160

  Fly   389 NTSEIVLLNCEY-FANPASLTQVEWYRNDILVN--VNDTTHYKGGNSENV--ALVIKSTEKEDIG 448
            ...:.:.|.|.. .|.||:  .:.|.|...::|  ....|..:.|..|::  .|.|...:.|:..
Mouse   161 RAGDPLNLTCHADNAKPAA--SIIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQ 223

  Fly   449 NYSCQLSNNIGKGTSDQKINLDVQYAPTVEILMIPEGPVKESDESNVTLFCNVLDANPSVLTKVR 513
            :..|:.:|....|..:..:.:|:|:.|.|.:.:.|: ||.|  ::.||..|:. .|||:| |:.|
Mouse   224 SIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQ-PVLE--DNIVTFHCSA-KANPAV-TQYR 283

  Fly   514 WYANSTLLKELP-DCEETREDLCHIDPSKLLLESIGRGFFYNY-----SCEGFNAAG-------- 564
            |.....::||.. :...|..|                   |.|     |||..||.|        
Mouse   284 WAKRGHIIKEASGELYRTTVD-------------------YTYFSEPVSCEVTNALGSTNLSRTV 329

  Fly   565 ---WGPR--SEDKELLVHYEPGPAALSHFPLVAVKKKSVTFSCS-VDDPGFPESNRFRWLRGGRG 623
               :|||  ||.:.|||  :.|..|:              |||: :.:|    |....|::.|.|
Mouse   330 DVYFGPRMTSEPQSLLV--DLGSDAV--------------FSCAWIGNP----SLTIVWMKRGSG 374

  Fly   624 PLQDIV---TKDWTVEPVGLDSRTNYSCYA----YNEGGKGVMATVNLEVHAPPFFIKNLPPYTG 681
                :|   .|..|::.|..:....|.|.|    ...|.:.|..|||    .||........:. 
Mouse   375 ----VVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVN----GPPIISSTQTQHA- 430

  Fly   682 ILHSSPNATLTCRIECVPRCD-ISWQKDGVPIERNDSRYFIKEKYMDASPATGDFESMLSVLHFN 745
             ||.. ...:.|.|...|..| |:|.              .||..:::..:              
Mouse   431 -LHGE-KGQIKCFIRSTPPPDRIAWS--------------WKENVLESGTS-------------- 465

  Fly   746 MPNWPDSKFNIEADNANYSCVSTGNIVGGSIRSRTYFGIEYAPENTTVSENIVYVQEDTIPGRVI 810
                  .::.:|..|.....:||                      .|:| |||.....||     
Mouse   466 ------GRYTVETVNTEEGVIST----------------------LTIS-NIVRADFQTI----- 496

  Fly   811 CKSRANPEPSYKWIFKNETIANGNALIINTAMNRNDDGTYTCLAYNKHGSSIAKTVIKVQFKPRC 875
                                                   |.|.|:|..||.             .
Mouse   497 ---------------------------------------YNCTAWNSFGSD-------------T 509

  Fly   876 EIERQEIDDQDTLICTAYGNPIEADFSWSIKTENETDENLGSGKKENSVEKSFYILQTDYAISRT 940
            ||.|.:                          |..::...|:|.:..||..:..|          
Mouse   510 EIIRLK--------------------------EQGSEMKSGAGLEAESVPMAVII---------- 538

  Fly   941 YRCVANNTVGYGPFCEIEVAEQLAWWQLWEKNTLIILVAAILGLLLTVIVICCIIICICRRRRRQ 1005
                 ...||.|                          .|.|.|:.|::..||     .|.:|  
Mouse   539 -----GVAVGAG--------------------------VAFLVLMATIVAFCC-----ARSQR-- 565

  Fly  1006 DKYLTEVPINSIQSALSDQLDMSRAGRNLSTQDKCTAILPNPSSSRFIGSAPKSPPRWPIRPGVM 1070
                                  |..||            |..|..   |:..|:..|.|.|..:.
Mouse   566 ----------------------STGGR------------PGISGR---GTEKKARLRLPRRANLK 593

  Fly  1071 LHVSSNTKENLTVNRMTVKPNVSGNRGDMSQLSAQLSAALNGSRDNSDGTILTEISAVSGE-NEA 1134
            ..||:  |.::.|..:..:|: ||                   |:..|.|.:.::....|| .:.
Mouse   594 GVVSA--KNDIRVEIVHKEPS-SG-------------------REAEDHTTIKQLMMDRGEFQQD 636

  Fly  1135 SNLSILEVTNRKKATVPSTIRNVSTAEGEIISSKT----HSAGHIALDHVWSLIFKKSDDRTRDS 1195
            |.|..|||...::    ...:|:........|..|    ||...|:|...      :.|.|....
Mouse   637 SVLKQLEVLKEEE----KEFQNLKDPTNGYYSVNTFKEHHSTPTISLSSC------QPDLRPTGK 691

  Fly  1196 QRSHVGLL------------------QTFWRGLGA---------------KESTSGFESQHRLKG 1227
            ||...|:.                  |.|..|:|:               .:|:|..::|     
Mouse   692 QRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQ----- 751

  Fly  1228 IRCSGSVTY-----------KKAKETVHSTSDAASNGESSLTKRPNNCQPSVSIQLQSNME 1277
              |..||:.           |.:|.:..|:..:.|:.::|...||          ||..|:
Mouse   752 --CDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRP----------LQRRMQ 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 V-set 44..152 CDD:462230
Ig strand B 183..187 CDD:409353
Ig <185..248 CDD:472250
Ig strand C 197..201 CDD:409353
Ig strand E 225..229 CDD:409353
Ig strand F 239..244 CDD:409353
Ig strand G 253..256 CDD:409353
Ig 277..354 CDD:472250 18/91 (20%)
Ig strand B 283..287 CDD:409353 2/3 (67%)
Ig strand C 297..301 CDD:409353 1/3 (33%)
Ig strand E 333..337 CDD:409353 0/3 (0%)
Ig strand F 347..352 CDD:409353 2/4 (50%)
Ig_3 376..456 CDD:464046 19/87 (22%)
Ig 676..779 CDD:472250 14/103 (14%)
Ig strand B 689..693 CDD:409353 0/3 (0%)
Ig strand C 702..706 CDD:409353 2/4 (50%)
Ig strand E 734..741 CDD:409353 0/6 (0%)
Ig strand F 762..767 CDD:409353 0/4 (0%)
Ig <811..869 CDD:472250 6/57 (11%)
Ig strand C 820..824 CDD:143205 0/3 (0%)
Ig strand F 849..854 CDD:143205 2/4 (50%)
Ig strand G 862..865 CDD:143205 0/2 (0%)
PTZ00112 1747..>1940 CDD:240274
Kirrel3NP_001420714.1 IG_like 54..143 CDD:214653 21/110 (19%)
Ig strand B 65..69 CDD:409390 2/3 (67%)
Ig strand C 73..81 CDD:409390 0/7 (0%)
Ig strand E 110..114 CDD:409390 0/3 (0%)
Ig strand F 124..129 CDD:409390 2/4 (50%)
Ig strand G 135..139 CDD:409390 2/7 (29%)
IgI_2_KIRREL3-like 149..246 CDD:409416 20/99 (20%)
Ig strand A 150..153 CDD:409416 1/2 (50%)
Ig strand A' 156..160 CDD:409416 2/4 (50%)
Ig strand B 167..174 CDD:409416 2/6 (33%)
Ig strand C 179..184 CDD:409416 0/6 (0%)
Ig strand C' 187..189 CDD:409416 0/1 (0%)
Ig strand D 192..199 CDD:409416 0/6 (0%)
Ig strand E 206..214 CDD:409416 2/7 (29%)
Ig strand F 223..231 CDD:409416 1/7 (14%)
Ig strand G 237..243 CDD:409416 0/5 (0%)
Ig <267..334 CDD:472250 22/87 (25%)
Ig strand B 267..271 CDD:409437 2/3 (67%)
Ig strand C 280..285 CDD:409437 2/4 (50%)
Ig strand E 304..308 CDD:409437 2/22 (9%)
Ig strand G 326..329 CDD:409437 0/2 (0%)
Ig 335..416 CDD:472250 26/104 (25%)
Ig strand B 352..356 CDD:409549 2/17 (12%)
Ig strand C 365..369 CDD:409549 0/3 (0%)
Ig strand E 381..385 CDD:409549 1/3 (33%)
IgI_5_KIRREL3 418..515 CDD:409479 32/213 (15%)
Ig strand A 419..423 CDD:409479 2/3 (67%)
Ig strand A' 425..428 CDD:409479 0/2 (0%)
Ig strand B 436..443 CDD:409479 1/6 (17%)
Ig strand C 450..455 CDD:409479 2/18 (11%)
Ig strand C' 457..460 CDD:409479 1/2 (50%)
Ig strand D 468..475 CDD:409479 1/6 (17%)
Ig strand E 478..485 CDD:409479 2/28 (7%)
Ig strand F 496..503 CDD:409479 4/50 (8%)
Ig strand G 506..513 CDD:409479 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.