DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Ceacam12

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_080363.2 Gene:Ceacam12 / 67315 MGIID:1914565 Length:300 Species:Mus musculus


Alignment Length:310 Identity:57/310 - (18%)
Similarity:104/310 - (33%) Gaps:117/310 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 PISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVND-TTHY 427
            |.::.:|:|       .|.|.|:..:...:.:.|.     |.::..:.||:...|:.:.: ..|.
Mouse    31 PTTAQITIE-------SVPPIAVEGDNVLLFVQNL-----PENVQTLSWYKGGKLLKMFEIARHV 83

  Fly   428 KGGNS--------------ENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKIN---------- 468
            ...||              .|.:|:||:..::|.|.|:.|:.:.    ||.::|.          
Mouse    84 IATNSSVMGPAHSGRETMLNNGSLMIKNVTRKDSGYYTLQILDT----TSRREIMRAEFFVQRPI 144

  Fly   469 LDVQYAPT--VEILMIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWY---------------- 515
            |..:..||  ::|..:|  |..|.::..:.|..|:    |..|....|:                
Mouse   145 LGFRKHPTSQLKIEFVP--PRIEENDDVLLLVYNL----PENLQGFVWHKGVFPVDHFKIASHSF 203

  Fly   516 -ANSTL-----LKELPDCEETREDLCHIDPSKLLLESIGRGFFYNYSCEGFNAAGWGPRSEDKEL 574
             .|||:     |..|..|.:          ..|||..:.:                    ||   
Mouse   204 LTNSTMLGRTYLDRLTVCSD----------GSLLLSKVSQ--------------------ED--- 235

  Fly   575 LVHYEPGPAALSHFPLVAVKKKSVTFSCSVDDPGFPESNRFRWLRGGRGP 624
                 .|..:|...|:..:.:.::.: ..|:..|       ||..|.:.|
Mouse   236 -----TGLYSLRTIPVDLMSESAIVY-LKVNKHG-------RWASGNQQP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845
IG_like 383..463 CDD:214653 18/94 (19%)
Ig 394..463 CDD:143165 16/83 (19%)
Ig_3 585..652 CDD:290638 8/40 (20%)
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Ceacam12NP_080363.2 Ig_CEACAM_D1 36..140 CDD:143251 24/119 (20%)
Ig_CEACAM_D1 155..259 CDD:143251 23/148 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.