DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Ceacam11

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_075778.2 Gene:Ceacam11 / 66996 MGIID:1914246 Length:303 Species:Mus musculus


Alignment Length:342 Identity:63/342 - (18%)
Similarity:113/342 - (33%) Gaps:128/342 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 PISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFAN-PASLTQVEWYRN-DILVNVNDTTH 426
            |.::.:|:|.: ||:         |...|.|||   :..| |.::..:.||.. ..|.|....:|
Mouse    31 PTTTQITIESV-PPI---------AVEGENVLL---FVHNLPENVQTLSWYTGVKPLKNCEIASH 82

  Fly   427 YKGGNS--------------ENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTV 477
            ....||              :|.:|:||||.::|.|.|:.|:.:...:                 
Mouse    83 VTATNSTVVGPAHSGREIVLKNGSLLIKSTTRKDSGYYTLQILDTTSR----------------- 130

  Fly   478 EILMIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWYANSTLL--KELPDCEETREDLCHIDPS 540
                 ||                        |.:..::.:|.||  |:            |:.||
Mouse   131 -----PE------------------------LIRAEFFVHSPLLGYKK------------HLAPS 154

  Fly   541 KLLLESIGRGFFYNYSCEGFNAAGWGPRSEDKE---LLVHYEP----------GPAALSHFPLVA 592
            :|.::.:                  ..|.|:.:   |.|::.|          |...|.||.:.:
Mouse   155 QLTIKLV------------------PSRVEENDNILLQVYHLPQKLQGFAWHKGVLPLDHFKIAS 201

  Fly   593 VKKKSVTFSCSVDDPGFPESNRFRWLRGGRGPLQDIVTKD---WTVEPVGLDSRTNYSCYAYNEG 654
              ...:|.|..:   |....:|......|...|.::...|   :|...:.:|.::.:........
Mouse   202 --HSFLTHSTML---GSAYQDRVIICNDGTLVLLNVTQNDTGLYTFRTISVDLKSEWDILDLQVN 261

  Fly   655 GKGVMATVNLEVHAPPF 671
            ..|..|:.||...:.|:
Mouse   262 KPGNWASPNLRPTSKPW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845
IG_like 383..463 CDD:214653 24/95 (25%)
Ig 394..463 CDD:143165 22/84 (26%)
Ig_3 585..652 CDD:290638 12/69 (17%)
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Ceacam11NP_075778.2 Ig_CEACAM_D1 36..140 CDD:143251 31/162 (19%)
Ig_CEACAM_D1 156..252 CDD:143251 19/118 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.