DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and KIRREL1

DIOPT Version :10

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:919 Identity:184/919 - (20%)
Similarity:284/919 - (30%) Gaps:322/919 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSLVLVLCLALVDSSTAQVDTTISQQES-------QSVVLPCPVDAEKCGKLHSLN------WFK 78
            ||| ||..|.|.|:.:....|..||:.:       |..||||.:          ||      |.|
Human     2 LSL-LVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVL----------LNYSGIVQWTK 55

  Fly    79 GDDRIAAMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFIPEETCDNFN 143
              |.:|   ||..........:....:.:...|.|.|.|.:::|:..|.|..|     |..  ..
Human    56 --DGLA---LGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQAT-----EAA--LR 108

  Fly   144 GYRIELRVLVPPTEVVILDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQPEVSWFRGTKRLT 208
            ..|.:|.||:||.:.        ||..|.|: .:|.......||...|.:|...:.|||      
Human   109 SRRAKLTVLIPPEDT--------RIDGGPVI-LLQAGTPHNLTCRAFNAKPAATIIWFR------ 158

  Fly   209 TYSPTHDLVDGLYTSTLELDWTLSREDLAQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGV 273
                     ||                                                      
Human   159 ---------DG------------------------------------------------------ 160

  Fly   274 KHHTVQGSKVVLTCDIHGARPAVNLTWYNTTTIISSGENEITEVRSKSLEKSDGTFHTQSELIFN 338
               |.|...|.                  :|.::..|:.|.                |.|:|:.|
Human   161 ---TQQEGAVA------------------STELLKDGKRET----------------TVSQLLIN 188

  Fly   339 ATRFENDRVFRCEAENIVLQINREKPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFAN 403
            .|..:..|||.|.:.|..:...:|    :::.|:|.:||.|.:|....|....|.|:..|:..||
Human   189 PTDLDIGRVFTCRSMNEAIPSGKE----TSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATAN 249

  Fly   404 PASLTQVEWYRNDILVNVNDTTHYKGGNSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKIN 468
            | .:....|.:...|:.....:.|:..       |..|...|.:   ||::.|.:|.......:|
Human   250 P-EILGYRWAKGGFLIEDAHESRYETN-------VDYSFFTEPV---SCEVHNKVGSTNVSTLVN 303

  Fly   469 LDVQYAPTVEILMIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWYANSTLLKELPDCEETRED 533
              |.:||.:   ::...|......|:|||.|..:...|..||   |....:.:...|........
Human   304 --VHFAPRI---VVDPKPTTTDIGSDVTLTCVWVGNPPLTLT---WTKKDSNMGPRPPGSPPEAA 360

  Fly   534 LCH---IDPSKLLLESIGRGFFYNYSCEGFNAAGWGPR--SEDKELLVHYEPGPAALSHFPLVAV 593
            |..   .:.::|||:|:.:.....|:|...     .||  ..::|:.::....|...|.....||
Human   361 LSAQVLSNSNQLLLKSVTQADAGTYTCRAI-----VPRIGVAEREVPLYVNGPPIISSEAVQYAV 420

  Fly   594 KKKSVTFSCSVDDPGFPESNRFRW-------------------LRGGRGPLQDIVTKDWTVEPV- 638
            :.......|.:...  |..:|..|                   ...|.|.|..:     |:..| 
Human   421 RGDGGKVECFIGST--PPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTL-----TINNVM 478

  Fly   639 GLDSRTNYSCYAYNEGGKGVM-----------------ATVNLEVHAPPFFIK------------ 674
            ..|.:|:|:|.|:|..|.|..                 ||:...:....|||.            
Human   479 EADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGS 543

  Fly   675 ----------------NLPPYTGILHS---SPNATLTCRIECVPRCDISWQKDGVPIERN----- 715
                            |..|.|  :||   ...|:::.... |.:...|..||.|.::::     
Human   544 RKDVTLRKLDIKVETVNREPLT--MHSDREDDTASVSTATR-VMKAIYSSFKDDVDLKQDLRCDT 605

  Fly   716 -DSRYFIKEKYMDASPATG--------DFESMLSVLH--FNMP------NWPDSKFNIEADNANY 763
             |:|    |:|....|..|        |..|..:||:  :..|      ..|.|:.:..:..|..
Human   606 IDTR----EEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQL 666

  Fly   764 SCVSTGNIVGGSIRSRTYFGIEYAPENT-----------TVS----ENIVYVQEDTIPGRVICKS 813
            :..|.|.            ..:|.||.|           |.|    ||.........||      
Human   667 NTYSRGP------------ASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPG------ 713

  Fly   814 RANPEPSYK 822
             |...|:|:
Human   714 -AAGYPTYR 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 V-set 44..152 CDD:462230 27/120 (23%)
Ig strand B 183..187 CDD:409353 0/3 (0%)
Ig <185..248 CDD:472250 9/62 (15%)
Ig strand C 197..201 CDD:409353 0/3 (0%)
Ig strand E 225..229 CDD:409353 0/3 (0%)
Ig strand F 239..244 CDD:409353 0/4 (0%)
Ig strand G 253..256 CDD:409353 0/2 (0%)
Ig 277..354 CDD:472250 15/76 (20%)
Ig strand B 283..287 CDD:409353 1/3 (33%)
Ig strand C 297..301 CDD:409353 0/3 (0%)
Ig strand E 333..337 CDD:409353 2/3 (67%)
Ig strand F 347..352 CDD:409353 3/4 (75%)
Ig_3 376..456 CDD:464046 19/79 (24%)
Ig 676..779 CDD:472250 26/127 (20%)
Ig strand B 689..693 CDD:409353 1/3 (33%)
Ig strand C 702..706 CDD:409353 1/3 (33%)
Ig strand E 734..741 CDD:409353 2/6 (33%)
Ig strand F 762..767 CDD:409353 0/4 (0%)
Ig <811..869 CDD:472250 3/12 (25%)
Ig strand C 820..824 CDD:143205 1/3 (33%)
Ig strand F 849..854 CDD:143205
Ig strand G 862..865 CDD:143205
PTZ00112 1747..>1940 CDD:240274
KIRREL1XP_005245362.1 Ig 22..116 CDD:472250 26/115 (23%)
Ig strand B 38..42 CDD:409353 2/3 (67%)
Ig strand C 51..54 CDD:409353 0/2 (0%)
Ig strand E 78..87 CDD:409353 2/8 (25%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 109..112 CDD:409353 0/2 (0%)
IgI_2_KIRREL3-like 122..219 CDD:409416 32/215 (15%)
Ig strand A 123..126 CDD:409416 1/10 (10%)
Ig strand A' 129..133 CDD:409416 1/4 (25%)
Ig strand B 140..147 CDD:409416 2/6 (33%)
Ig strand C 152..157 CDD:409416 0/4 (0%)
Ig strand C' 160..162 CDD:409416 1/58 (2%)
Ig strand D 165..172 CDD:409416 2/24 (8%)
Ig strand E 179..187 CDD:409416 4/23 (17%)
Ig strand F 196..204 CDD:409416 4/7 (57%)
Ig strand G 210..216 CDD:409416 1/9 (11%)
Ig_3 222..291 CDD:464046 19/79 (24%)
Ig_3 308..389 CDD:464046 19/86 (22%)
IgI_5_KIRREL3 407..504 CDD:409479 21/103 (20%)
Ig strand A 408..412 CDD:409479 1/3 (33%)
Ig strand A' 414..417 CDD:409479 0/2 (0%)
Ig strand B 425..432 CDD:409479 1/6 (17%)
Ig strand C 439..444 CDD:409479 2/4 (50%)
Ig strand C' 446..449 CDD:409479 0/2 (0%)
Ig strand D 457..464 CDD:409479 0/6 (0%)
Ig strand E 467..474 CDD:409479 2/11 (18%)
Ig strand F 485..492 CDD:409479 3/6 (50%)
Ig strand G 495..502 CDD:409479 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.