DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Sirpb1a

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_001002898.1 Gene:Sirpb1a / 320832 MGIID:2444824 Length:391 Species:Mus musculus


Alignment Length:408 Identity:88/408 - (21%)
Similarity:153/408 - (37%) Gaps:85/408 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLVLCLALVDSSTAQVDTTISQQESQ-------SVVLPCPVDAEKCGKLHSLNWFKGDDRIAAML 87
            ||:|.|.|.....|..:..:.|....       |..|.|.|.:  ...:..:.|::|..:...::
Mouse    14 VLLLILLLGFKGAAVRELKVIQPVKSFFVGAGGSATLNCTVTS--LLPVGPIRWYRGVGQSRLLI 76

  Fly    88 ---LGD-----SNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTF--FIPEETCDNF 142
               .|:     :||:.|.|.       ....:.:.|.::..||...|.| ..|  ...|...:..
Mouse    77 YPFTGEHSPRITNVSDVTKR-------NNMDFSIRISNVTPADSGTYYC-VKFQRGSSEPDIEIQ 133

  Fly   143 NGYRIELRVLVPPTEVVILDAKGDRIKNGSVVGPMQE---RQSLKATCTVRNTRPQP-EVSWFRG 203
            :|...||.||..|:..:             |.||...   :|::..||......|:. .:.||:.
Mouse   134 SGGGTELLVLAKPSSPM-------------VSGPAARAVPQQTVTFTCRSHGFFPRNLTLKWFKN 185

  Fly   204 TKRL----TTYSPTHDLVDGLYTSTLELDWTLSREDLAQDIECRVKSAAIQNVT---VTKFSVDL 261
            ...:    |:..|....|....:||:::  .|...|:...|.|.|....:....   :...|..:
Mouse   186 GDEISHLETSVEPEETSVSYRVSSTVQV--VLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFI 248

  Fly   262 QVRPTSIDINGVKHHTVQGSKVVLTCDIHG-ARPAVNLTWYNTTTIISSGENEITEVRSKSLEKS 325
            ||.|| ::|.  :..|:..:.:.:||.|.. ..|:..|||      :.:|.....||....:...
Mouse   249 QVPPT-LEIR--QQPTMVWNVINVTCQIQKFYPPSFQLTW------LENGNISRREVPFTLIVNK 304

  Fly   326 DGTFHTQSELIFNATRFENDRVFRCEAEN------------IVLQINREKPISSALTLEVLYPPV 378
            |||::..|.|:.|.:..|.:.|..|:.|:            :|.:..|.|.:.:|        .:
Mouse   305 DGTYNWISCLLVNISALEENMVVTCKVEHDEQAEVIETHTVLVTEHQRVKELKTA--------GI 361

  Fly   379 VKVSPSAITANTSEIVLL 396
            .|: |.|:... |:|:||
Mouse   362 AKI-PVAVLLG-SKILLL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845 22/124 (18%)
Ig 176..248 CDD:299845 17/79 (22%)
Ig 277..354 CDD:299845 20/77 (26%)
IG_like 383..463 CDD:214653 6/14 (43%)
Ig 394..463 CDD:143165 2/3 (67%)
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Sirpb1aNP_001002898.1 IG_like 42..119 CDD:214653 16/86 (19%)
V-set 45..143 CDD:284989 21/107 (20%)
Ig 142..252 CDD:299845 25/124 (20%)
IgC 247..341 CDD:143166 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.