DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Sirpb3

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:XP_006235033.1 Gene:Sirpb3 / 296149 RGDID:1566226 Length:487 Species:Rattus norvegicus


Alignment Length:417 Identity:91/417 - (21%)
Similarity:151/417 - (36%) Gaps:111/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VILDAKGDRIKNGSVV------GPMQERQSLKATCTVRNTRPQPEVSWFRGTKRLTTYSPTHDLV 217
            :.|.....|:.:.::|      ||...|..              .|||.:.:......:|....|
  Rat    37 ISLKGPDHRVTSSNLVQFLCTAGPFSSRNL--------------SVSWLKNSNEHPASAPQLVPV 87

  Fly   218 DGLYTSTLELDW-TLSREDLAQDIECRVKSAAIQ---NVTVTKFSVDLQVRPT---SIDINGVKH 275
            :....|.....| .|:::|:...|.|:|....|.   .:|:....| ::|.||   :.:...::.
  Rat    88 NNHSYSVTSKAWVALTKQDILSQITCKVTHGDIDEPLRMTINLSQV-VRVTPTLKITTEPPEIQD 151

  Fly   276 HTVQGSKVVLTCDIHGARPA-VNLTWYNTTTIISSGENEITEVRSKSLEKSDGTF---HT-QSEL 335
            |..|  :|.|||.:....|. :.|.|      ..:|...:|...:::...||||:   || |.:.
  Rat   152 HAHQ--RVNLTCHVSNFYPQNMRLIW------AKNGHKILTVEHTQATRNSDGTYSVQHTLQEDA 208

  Fly   336 IFNATRF-----ENDRVFRCEAENIVLQINREKPISSALTLEV-------------LYPPVVKVS 382
            |.|.|.|     ::|                :.|:..::||..             |..|:.:.:
  Rat   209 ILNETNFICWVIQDD----------------QPPVRDSITLGTPRKVRGRKDYSHNLEGPLQRFA 257

  Fly   383 PSA---ITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVNDTTHYKGGNSENV-ALVIKSTE 443
            |.|   :...:||:          |.....|.|.:|:..:....|..:.||.:.|| :.|:...|
  Rat   258 PGASIQLKYTSSEL----------PTRQVTVIWLKNNHSLLQTQTNVFSGGETYNVTSTVLVPLE 312

  Fly   444 KEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEILMIPEGPVKESDESN----VTLFCNVLDA 504
            .:||.:....|..:.......:.|.|| ||      |.:|.. |:.|..|.    ||:.|:|   
  Rat   313 SDDILSLVLCLVEHKSLVVFQKVIYLD-QY------LYVPPA-VRVSQSSTVSSLVTVTCHV--- 366

  Fly   505 NPSVLTKVRWYANSTLLKELPDCEETR 531
                   .|:|.....|..|.||...|
  Rat   367 -------ERFYPKDICLTWLEDCHVIR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845 14/72 (19%)
Ig 277..354 CDD:299845 22/86 (26%)
IG_like 383..463 CDD:214653 18/83 (22%)
Ig 394..463 CDD:143165 14/69 (20%)
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Sirpb3XP_006235033.1 Ig 34..138 CDD:299845 22/115 (19%)
IgC 146..219 CDD:143166 22/80 (28%)
Ig 251..346 CDD:299845 25/111 (23%)
IgC 348..430 CDD:143166 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.