DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Ceacam9

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_036057.1 Gene:Ceacam9 / 26368 MGIID:1347247 Length:234 Species:Mus musculus


Alignment Length:236 Identity:59/236 - (25%)
Similarity:88/236 - (37%) Gaps:65/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 VLTCDIHGARPAVNLTWYNTTTIISSGENEI---------------------------------T 315
            :|||  ..|..|..||......:::.|.|.:                                 |
Mouse    23 LLTC--WNAPAAAELTIELVPPMVAEGGNSVLFVHEMPLNVQAFYWYKQRDSTKSYEVARYLTPT 85

  Fly   316 EVRSKSLEKSD--GTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALT---LEVLY 375
            ...||..:.||  ..|::.|.||.|.|:.::. |:      .:|..|.|  :.|.||   |||..
Mouse    86 NQSSKMPQHSDRKTVFYSGSLLIRNVTKADSG-VY------TLLTFNTE--MESELTHVHLEVQE 141

  Fly   376 P---PVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVNDTTHYKGGNSENVAL 437
            |   |.::...:|:|...|  |.|.| ...:|.  ..:.|..|...:..||.......||.   |
Mouse   142 PVAQPTLQADSTAVTEAGS--VTLTC-VSEDPG--LSIRWLFNHQGLYFNDRMTLSQKNSR---L 198

  Fly   438 VIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVE 478
            .|...::||.|.|.|::||..     ..|::|.:|.:.|.|
Mouse   199 TIDPAKREDAGEYQCEVSNGY-----SSKMSLPLQMSVTSE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845 21/104 (20%)
IG_like 383..463 CDD:214653 22/79 (28%)
Ig 394..463 CDD:143165 19/68 (28%)
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Ceacam9NP_036057.1 Ig_CEACAM_D1 35..139 CDD:143251 23/112 (21%)
IG_like <86..139 CDD:214653 18/61 (30%)
IG_like 152..219 CDD:214653 22/74 (30%)
IGc2 159..220 CDD:197706 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.