Sequence 1: | NP_001246890.1 | Gene: | nrm / 40515 | FlyBaseID: | FBgn0262509 | Length: | 2192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036057.1 | Gene: | Ceacam9 / 26368 | MGIID: | 1347247 | Length: | 234 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 59/236 - (25%) |
---|---|---|---|
Similarity: | 88/236 - (37%) | Gaps: | 65/236 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 VLTCDIHGARPAVNLTWYNTTTIISSGENEI---------------------------------T 315
Fly 316 EVRSKSLEKSD--GTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALT---LEVLY 375
Fly 376 P---PVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVNDTTHYKGGNSENVAL 437
Fly 438 VIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVE 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nrm | NP_001246890.1 | Ig | 44..152 | CDD:299845 | |
Ig | 176..248 | CDD:299845 | |||
Ig | 277..354 | CDD:299845 | 21/104 (20%) | ||
IG_like | 383..463 | CDD:214653 | 22/79 (28%) | ||
Ig | 394..463 | CDD:143165 | 19/68 (28%) | ||
Ig_3 | 585..652 | CDD:290638 | |||
Ig | 685..>719 | CDD:299845 | |||
IG_like | 788..869 | CDD:214653 | |||
Ig | <811..869 | CDD:299845 | |||
Ceacam9 | NP_036057.1 | Ig_CEACAM_D1 | 35..139 | CDD:143251 | 23/112 (21%) |
IG_like | <86..139 | CDD:214653 | 18/61 (30%) | ||
IG_like | 152..219 | CDD:214653 | 22/74 (30%) | ||
IGc2 | 159..220 | CDD:197706 | 20/73 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |