DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and CG30350

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:149 Identity:27/149 - (18%)
Similarity:57/149 - (38%) Gaps:35/149 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 DTTHYKGGNSENVALVIKSTEK-----EDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEILMI 482
            ||.|    ...::.:.:.:.||     .|.|....::::.:..|.||:::.......|...:.:.
  Fly   126 DTVH----AVSSIPMALLTLEKLERDNRDFGRRILEVNSEVDSGLSDKRMREGRSSTPVAPLELP 186

  Fly   483 PEG---------PVKESDESNVTLF-------CNVLDANPSVLTKVRWYANS---TLLKELPDCE 528
            |:.         |:.:||.....||       ..:.||.|.....|:.|..:   .:|:.:..| 
  Fly   187 PQAMAKYEAFNIPLPKSDAELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSC- 250

  Fly   529 ETREDLCHIDPSKLLLESI 547
                 :|: ..||.:::.:
  Fly   251 -----MCN-QHSKFMVKRL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845
IG_like 383..463 CDD:214653 8/44 (18%)
Ig 394..463 CDD:143165 8/44 (18%)
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 7/32 (22%)
cyclophilin 212..369 CDD:294131 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.