DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Kirrel2

DIOPT Version :10

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_766486.1 Gene:Kirrel2 / 243911 MGIID:2442334 Length:700 Species:Mus musculus


Alignment Length:736 Identity:167/736 - (22%)
Similarity:258/736 - (35%) Gaps:231/736 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQESQSVV-------LPCPVDAEKCGKLHSLNWFKGDDRIAAMLLGDSNVTSVNKEFDERVTVEQ 108
            ||....||       |||.:.|.:    ..:.|.|  |.:|  |.|:.::...:     |..:..
Mouse    25 QQPEDMVVLLGEEARLPCALGAYR----GLVQWTK--DGLA--LGGERDLPGWS-----RYWISG 76

  Fly   109 N----PYRLVIKDLKIADEDIYLCDTTFFIPEETCDNFNGYR---IELRVLVPPTEVVILDAKGD 166
            |    .:.|.||.:::.||..|.|..          :..|.|   .:|.|:|||....:|.....
Mouse    77 NSASGQHDLHIKPVELEDEASYECQA----------SQAGLRSRPAQLHVMVPPEAPQVLGGPSV 131

  Fly   167 RIKNGSVVGPMQERQSLKATCTVR-NTRPQPEVSWFRGTKRL--TTYSPT--HDLVDGLYTSTLE 226
            .:..| |.|.:        ||..| ::||.||:.|||...||  :::..|  .|...|...:||.
Mouse   132 SLVAG-VPGNL--------TCRSRGDSRPAPELLWFRDGIRLDGSSFHQTTLKDKATGTVENTLF 187

  Fly   227 LDWTLSREDLAQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHG 291
            |  |.|..|....:.||.:|.|:.....|..::.||. |..:.::.......:|.||...|....
Mouse   188 L--TPSSHDDGATLICRARSQALPTGRDTAVTLSLQY-PPMVTLSAEPQTVQEGEKVTFLCQATA 249

  Fly   292 ARPAVNLTWYNTTTIISSGENEITEVRSKSLE-KSDGTFHTQSELIFNATRFENDRVFRCEAENI 355
            ..|.....|       :.|.:.:...|...|| .:|.||.|:.              ..||..|.
Mouse   250 QPPVTGYRW-------AKGGSPVLGARGPRLEVVADATFLTEP--------------VSCEVSNA 293

  Fly   356 VLQINREKPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVN 420
            |...||      :..|||||.|:::..|.:::.:..:....:|.:..||  |.::.|.|      
Mouse   294 VGSANR------STALEVLYGPILQAKPKSVSVDVGKDASFSCVWRGNP--LPRITWTR------ 344

  Fly   421 VNDTTHYKGGN---SENVALVIKSTEKEDIGNYSCQLS---NNIGKGTSDQKINLDVQYAPTVEI 479
                   .||:   |....|.:.|...||.|:|.|:..   ..:|.|.:..::.::   ||.|..
Mouse   345 -------MGGSQVLSSGPTLRLPSVALEDAGDYVCRAEPRRTGLGGGKAQARLTVN---APPVVT 399

  Fly   480 LMIP-----EGPVKESDESNVTLFCNVLDANPSVLTKVRWYANSTLLKELPDCEETREDLCHIDP 539
            .:.|     .||.:        |.| |:.|:|:                 ||......|      
Mouse   400 ALQPAPAFLRGPAR--------LQC-VVFASPA-----------------PDSVVWSWD------ 432

  Fly   540 SKLLLESIGRGFFYNYSCEGFNAAGWGPRSEDKELLVHYEPGPAALSHFPLVAVKKKSVTFSCSV 604
                              |||..||                   :|..|.:.|            
Mouse   433 ------------------EGFLEAG-------------------SLGRFLVEA------------ 448

  Fly   605 DDPGFPESNRFRWLRGGRGP-LQDIVTKDWTVEPVGLDSRTNYSCYAYNEGGKGVMATVNLEVHA 668
                ||...    :.||:|| |..::....|.|.   |..|.::|.|.|..|:|     .:::|.
Mouse   449 ----FPAPE----VEGGQGPGLISVLHISGTQES---DFTTGFNCSARNRLGEG-----RVQIHL 497

  Fly   669 PPFFIKNLPPYTGILHSSPNA--TLTCRIECVPRC-----DISWQKDGVPI----ERNDSRYFIK 722
            ..   ::|.|...|:..:.:|  :|...|..|..|     .:|.||:.|.|    |.:.||    
Mouse   498 GR---RDLLPTVRIVAGAASAATSLLMVITGVVLCCWRHGSLSKQKNLVRIPGSSEGSSSR---- 555

  Fly   723 EKYMDASPATGDFESMLSVLH 743
                .....||..|....::|
Mouse   556 ----GPEEETGSSEDRGPIVH 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 V-set 44..152 CDD:462230 26/114 (23%)
Ig strand B 183..187 CDD:409353 0/3 (0%)
Ig <185..248 CDD:472250 24/67 (36%)
Ig strand C 197..201 CDD:409353 1/3 (33%)
Ig strand E 225..229 CDD:409353 2/3 (67%)
Ig strand F 239..244 CDD:409353 1/4 (25%)
Ig strand G 253..256 CDD:409353 0/2 (0%)
Ig 277..354 CDD:472250 16/77 (21%)
Ig strand B 283..287 CDD:409353 1/3 (33%)
Ig strand C 297..301 CDD:409353 0/3 (0%)
Ig strand E 333..337 CDD:409353 0/3 (0%)
Ig strand F 347..352 CDD:409353 1/4 (25%)
Ig_3 376..456 CDD:464046 18/85 (21%)
Ig 676..779 CDD:472250 20/79 (25%)
Ig strand B 689..693 CDD:409353 2/5 (40%)
Ig strand C 702..706 CDD:409353 1/3 (33%)
Ig strand E 734..741 CDD:409353 1/6 (17%)
Ig strand F 762..767 CDD:409353
Ig <811..869 CDD:472250
Ig strand C 820..824 CDD:143205
Ig strand F 849..854 CDD:143205
Ig strand G 862..865 CDD:143205
PTZ00112 1747..>1940 CDD:240274
Kirrel2NP_766486.1 IG_like 27..116 CDD:214653 24/111 (22%)
Ig strand B 38..42 CDD:409353 1/3 (33%)
Ig strand C 51..54 CDD:409353 0/2 (0%)
Ig strand E 77..87 CDD:409353 2/9 (22%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 109..112 CDD:409353 0/2 (0%)
Ig 122..220 CDD:472250 30/108 (28%)
Ig strand B 139..143 CDD:409353 1/11 (9%)
Cell attachment site. /evidence=ECO:0000255 146..148 1/1 (100%)
Ig strand C 154..158 CDD:409353 1/3 (33%)
Ig strand E 184..188 CDD:409353 2/3 (67%)
Ig strand F 198..203 CDD:409353 1/4 (25%)
Ig strand G 213..216 CDD:409353 1/2 (50%)
Ig_3 223..292 CDD:464046 17/89 (19%)
Ig 315..392 CDD:472250 19/91 (21%)
Ig strand B 326..330 CDD:409353 0/3 (0%)
Ig strand C 339..343 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 0/2 (0%)
Ig 394..498 CDD:472250 39/200 (20%)
Ig strand B 412..416 CDD:319310 1/11 (9%)
Ig strand C 426..430 CDD:319310 0/3 (0%)
Ig strand E 464..468 CDD:319310 0/3 (0%)
Ig strand F 479..484 CDD:319310 1/4 (25%)
Ig strand G 492..495 CDD:319310 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..576 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..700
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.