DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and Cd22

DIOPT Version :10

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:XP_006539552.1 Gene:Cd22 / 12483 MGIID:88322 Length:879 Species:Mus musculus


Alignment Length:750 Identity:175/750 - (23%)
Similarity:298/750 - (39%) Gaps:160/750 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 NVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGA--RPAVNLTWYNTTTIISSGENE 313
            ||:...|...:|: |:.|.         :...|.|||.::.:  ...:.|.|:...:.|:|..:.
Mouse   156 NVSEKPFQPYIQM-PSEIR---------ESQSVTLTCGLNFSCFGYDILLKWFLEDSEITSITSS 210

  Fly   314 ITEVRSKSLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISS-ALTLEVLYPP 377
            :|.:.| |:..|....:|:|:|.|.....::.:..:|:.:      :..|.:|. .:.|:|.|.|
Mouse   211 VTSITS-SVTSSIKNVYTESKLTFQPKWTDHGKSVKCQVQ------HSSKVLSERTVRLDVKYTP 268

  Fly   378 --VVKVSPSAITANTSEIVLLNCEY-FANPASLT-QVEWYRNDILVNVNDTTHYKGGNSENVALV 438
              .:||:|:.:..|.|  |.:.|.. .:||...| .|.|:::...:...:...    ..:...|:
Mouse   269 KLEIKVNPTEVEKNNS--VTMTCRVNSSNPKLRTVAVSWFKDGRPLEDQELEQ----EQQMSKLI 327

  Fly   439 IKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEILMIPEGPVKESDESNVTLFCNVLD 503
            :.|..|:..|.|.||.||:||.|.|:: :.|.|.|||....:.|...|.:|.  .:|.|.|..| 
Mouse   328 LHSVTKDMRGKYRCQASNDIGPGESEE-VELTVHYAPEPSRVHIYPSPAEEG--QSVELICESL- 388

  Fly   504 ANPSVLTKVRWYANSTLLKELPDCEETREDLCHIDPSKLLLESIGRGFFYNYSCEGFNAAGWGPR 568
            |:||. |...||.|.   |.:|.  :|:|        ||.:..:......||||...|..|.|..
Mouse   389 ASPSA-TNYTWYHNR---KPIPG--DTQE--------KLRIPKVSPWHAGNYSCLAENRLGHGKI 439

  Fly   569 SEDKELLVHYEPGPAAL---SHFPLVAVKKKSVTFSCSVDDPGFPESNRFRWLRGGRGP------ 624
            .::.:|.|||.|.....   |..|:  ::..|||..|..:... |:...:||...|.|.      
Mouse   440 DQEAKLDVHYAPKAVTTVIQSFTPI--LEGDSVTLVCRYNSSN-PDVTSYRWNPQGSGSVLKPGV 501

  Fly   625 --LQDIVTKDWTVEPVGLDSRTNYSCYAYNEGGKGVMATVNLEVHAPPFFIKNLPPYTGILHSSP 687
              :|.:.   |...||        ||.|.|......:..: |.||..|..:|       :|..||
Mouse   502 LRIQKVT---WDSMPV--------SCAACNHKCSWALPVI-LNVHYAPRDVK-------VLKVSP 547

  Fly   688 NATLTCRIECVPRCDIS----------WQKDGVPIERNDSRYFIKEKYMDASPATGDFESMLSVL 742
            .:.:......:.:||.:          |:|:|..::  :.||.   .:...||            
Mouse   548 ASEIRAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQ--EGRYL---SFGSVSP------------ 595

  Fly   743 HFNMPNWPDSKFNIEADNANYSCVSTGNIVGGSIRSRTYFGIEYAPENTTVS----ENIVYVQED 803
                           .|:.||:|: ..|.:|.::.......:.|||....||    ::::..::.
Mouse   596 ---------------EDSGNYNCM-VNNSIGETLSQAWNLQVLYAPRRLRVSISPGDHVMEGKKA 644

  Fly   804 TIPGRVICKSRANPEPS-YKWIFKN--ETIANGNALIINTAMNRNDDGTYTCLAYNKHGSSIA-K 864
            |:.    |:|.|||..| |.|...:  :..::|..|.:. .:.....|:|.|...|..|:..: .
Mouse   645 TLS----CESDANPPISQYTWFDSSGQDLHSSGQKLRLE-PLEVQHTGSYRCKGTNGIGTGESPP 704

  Fly   865 TVIKVQFKPRCEIERQEIDDQDTL-ICTAYGNPIEADFSWSIKTENETDENLG-SGKKENSVEKS 927
            :.:.|.:.|....:|..:.....| ||..        ..|.:|.:.:..:|.. .|.:|||..:|
Mouse   705 STLTVYYSPETIGKRVALGLGFCLTICIL--------AIWGMKIQKKWKQNRSQQGLQENSSGQS 761

  Fly   928 FYILQTDYAISRT-----------YRCVANNTVGY 951
            |::  .:....||           |....::||.|
Mouse   762 FFV--RNKKARRTPLSEGPQSQGCYNPAMDDTVSY 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 V-set 44..152 CDD:462230
Ig strand B 183..187 CDD:409353
Ig <185..248 CDD:472250
Ig strand C 197..201 CDD:409353
Ig strand E 225..229 CDD:409353
Ig strand F 239..244 CDD:409353
Ig strand G 253..256 CDD:409353 0/2 (0%)
Ig 277..354 CDD:472250 17/78 (22%)
Ig strand B 283..287 CDD:409353 2/3 (67%)
Ig strand C 297..301 CDD:409353 1/3 (33%)
Ig strand E 333..337 CDD:409353 2/3 (67%)
Ig strand F 347..352 CDD:409353 1/4 (25%)
Ig_3 376..456 CDD:464046 20/83 (24%)
Ig 676..779 CDD:472250 18/112 (16%)
Ig strand B 689..693 CDD:409353 0/3 (0%)
Ig strand C 702..706 CDD:409353 1/13 (8%)
Ig strand E 734..741 CDD:409353 0/6 (0%)
Ig strand F 762..767 CDD:409353 3/4 (75%)
Ig <811..869 CDD:472250 15/61 (25%)
Ig strand C 820..824 CDD:143205 2/4 (50%)
Ig strand F 849..854 CDD:143205 2/4 (50%)
Ig strand G 862..865 CDD:143205 0/3 (0%)
PTZ00112 1747..>1940 CDD:240274
Cd22XP_006539552.1 Ig 37..158 CDD:472250 1/1 (100%)
Ig strand B 53..57 CDD:409523
Ig strand C 70..74 CDD:409523
Ig strand E 123..127 CDD:409523
Ig strand F 137..142 CDD:409523
Ig strand G 150..153 CDD:409523
Ig 162..264 CDD:472250 24/118 (20%)
Ig strand B 178..182 CDD:409532 2/3 (67%)
Ig strand C 194..198 CDD:409532 1/3 (33%)
Ig strand E 229..233 CDD:409532 2/3 (67%)
Ig strand F 243..248 CDD:409532 1/4 (25%)
Ig strand G 257..260 CDD:409532 0/2 (0%)
Ig 268..361 CDD:472250 28/99 (28%)
Ig strand B 285..289 CDD:409531 1/3 (33%)
Ig strand C 300..306 CDD:409531 2/5 (40%)
Ig strand E 318..328 CDD:409531 1/13 (8%)
Ig strand F 338..343 CDD:409531 2/4 (50%)
Ig strand G 352..355 CDD:409531 1/3 (33%)
Ig_3 375..432 CDD:464046 22/73 (30%)
Ig 451..>493 CDD:472250 10/44 (23%)
Ig strand B 470..474 CDD:409531 2/3 (67%)
Ig strand C 485..489 CDD:409531 1/3 (33%)
IG_like 550..621 CDD:214653 15/103 (15%)
Ig strand B 557..561 CDD:409531 0/3 (0%)
Ig strand C 572..576 CDD:409531 0/3 (0%)
Ig strand E 586..590 CDD:409531 2/6 (33%)
Ig strand F 600..605 CDD:409531 3/5 (60%)
Ig strand G 614..617 CDD:409531 0/2 (0%)
IG_like 637..709 CDD:214653 16/76 (21%)
Ig strand B 644..648 CDD:409353 1/7 (14%)
Ig strand C 658..662 CDD:409353 1/3 (33%)
Ig strand E 674..678 CDD:409353 1/3 (33%)
Ig strand F 688..693 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.