DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrm and si:ch211-74m13.1

DIOPT Version :9

Sequence 1:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:XP_001922015.4 Gene:si:ch211-74m13.1 / 100149459 ZFINID:ZDB-GENE-081104-12 Length:328 Species:Danio rerio


Alignment Length:306 Identity:75/306 - (24%)
Similarity:121/306 - (39%) Gaps:78/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ATCTVRNTRPQPEVSWFRGTKRLTTYSPTHD------LVDGLYTSTLEL---------DWTLSRE 234
            |.|.::...|:..|.:..........|.|||      .|.|:..|...|         ||.:...
Zfish    23 AECPLQINPPKLVVRFNSSASANCNTSVTHDGMGWEATVGGVPLSKANLITWRVSQLTDWKIEPP 87

  Fly   235 --DLAQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVN 297
              .:....:|.|...    ||:.|       .|.|:.|:.|.....:|::..|.||||...||.|
Zfish    88 FCYINYGKQCEVPLP----VTIYK-------TPDSVSISTVNQIMTEGNQYELQCDIHNVAPAQN 141

  Fly   298 LT--WYNTTTIISSGENEITEVRSKSLEKSDGTFHTQS------ELIFNATRFENDRVFRCEAEN 354
            ||  ||...|:::               :::.|.:|:|      .|:.:..|.::...:|||.| 
Zfish   142 LTINWYKGETLVN---------------QTNFTDNTKSPVNKIIRLLIHPDRADDGAQYRCETE- 190

  Fly   355 IVLQINREKP------ISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWY 413
              |.:..|.|      .|..|:::|.|.|  :.|.||...:.|:.|.|||...||||::  ..|:
Zfish   191 --LNLGVEGPQPPPKNTSKPLSIDVHYKP--QHSSSAENISQSDTVYLNCTVKANPAAV--YTWH 249

  Fly   414 RNDILVNVNDTTHYKGGNSENVALVIKSTEKEDIGNYSCQLSNNIG 459
                      :.|.|    |.::..:..:.....|.|:|..:|::|
Zfish   250 ----------SEHLK----EKISSPVIQSSPLSPGKYTCTATNDLG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845 16/79 (20%)
Ig 277..354 CDD:299845 22/84 (26%)
IG_like 383..463 CDD:214653 20/77 (26%)
Ig 394..463 CDD:143165 17/66 (26%)
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
si:ch211-74m13.1XP_001922015.4 Ig2_ICAM-1_like 109..209 CDD:143232 31/117 (26%)
Ig_2 217..281 CDD:290606 21/81 (26%)
IG_like 230..281 CDD:214653 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.