DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and jigr1

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:321 Identity:67/321 - (20%)
Similarity:106/321 - (33%) Gaps:106/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LKLIQMVHDNPILWDSRLPNFKGAEEEK---NRAWEHIGREFNAPGRRVARAFKSLRESYRRELA 122
            |.||:....:|:|:|.....||    :|   ...||.|..:.......:.....:||..|..|..
  Fly    31 LGLIREYRSHPVLYDRSNKRFK----DKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKR 91

  Fly   123 HVKLMGNGF---KPKWSLYEAMDFLRDVIRERKGASHAT------------DLSLTTYGHINN-- 170
            .|:   ||.   ..:|.|:|::.||.|.||.|:...:.:            |....:.||:|:  
  Fly    92 RVE---NGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIK 153

  Fly   171 --------------------------NNNNNNNSNSLAAGGKAMTLKLSNSFNE----------- 198
                                      ||::..|.:..:..|:....|..|.|.|           
  Fly   154 DELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPE 218

  Fly   199 ---SASVLNLSKCSSLNVSDDHYYCDYYVKPELDLSVGGGAGSSTSG--SSSGGGPLP------- 251
               |:.::|..:.   |.....:..|:..|..:|.|:      |.||  .:....|||       
  Fly   219 YIISSPIVNPMRS---NKRGSQHLDDHPSKRRVDDSL------SISGYYPTQPLAPLPPAYAKFR 274

  Fly   252 ------------LPAHQA-------HNDSRVSSTRNEQRAQHHSYEDMD--DSSIRSGDED 291
                        :||..|       ..:...||.|||........:::|  |.|..|.:||
  Fly   275 GFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGSKEKTDEVDPVDQSSESQEED 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 24/92 (26%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.