DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and CG6163

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster


Alignment Length:184 Identity:41/184 - (22%)
Similarity:72/184 - (39%) Gaps:34/184 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 APVS-GCLPTATH-------SLQDMSAAAAAIA-----LDMKPK--------------LEPHPLA 39
            |||: ..||||||       |...:..|....|     |..:|.              |.|.|..
  Fly   136 APVAPPPLPTATHGRGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTGLVPPPAT 200

  Fly    40 AAT---AMPSQKIKKLVRRNASDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRA-WEHIGREFN 100
            .|:   |.|.:|:.:....:.|.:.::|..:...|.||..|..:.||..:.:..| |:....|..
  Fly   201 VASETVATPPRKLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMG 265

  Fly   101 APGRRVARAFKSLRESYRREL---AHVKLMGNGFKPKWSLYEAMDFLRDVIRER 151
            .....:...:..:::.|..||   .|.:.....|:..|..::.|.|:|:::.::
  Fly   266 LTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 19/90 (21%)
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.