DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and hng1

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:95 Identity:32/95 - (33%)
Similarity:48/95 - (50%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELA 122
            ||.| |||.:.:.|.|:|.:||:|: ..:.|...|..:....|.......|.:..||:.|.|||.
  Fly    11 SDIL-LIQTIRETPSLYDPQLPSFR-LSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELK 73

  Fly   123 HVKLMGNGFKPKWSLYEAMDFLRDVIRERK 152
            ..:|..:|.......:..||||||.:|:|:
  Fly    74 QKRLHPSGEFGHNDFFRKMDFLRDFVRKRR 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 27/86 (31%)
hng1NP_611558.2 MADF 15..98 CDD:214738 26/83 (31%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.