DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and brwl

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster


Alignment Length:414 Identity:83/414 - (20%)
Similarity:146/414 - (35%) Gaps:116/414 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KLVRRNASDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRE 115
            ::::.:....::.:.:|..:..|:|.::|.::..:.:: :||..|.:|...........:::||.
  Fly    49 RVMQADEDFNIRFVNLVRTHKCLYDKKVPEYRNRDNQE-KAWVLISKETRESVIHCKERWRNLRA 112

  Fly   116 SYRRELAHVKLMGNGFKPK---WSLYEAMDFLRDVIRERKGASHATDLSLTTY----GHI----- 168
            ...|   ::| ..:|.:|:   :.|.|.|.||...::..:.:....:...|.|    .|:     
  Fly   113 CLSR---YIK-QQSGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPF 173

  Fly   169 ----------------NNNNNNNNNSNSLAAGGKAMTLKLSNSFNESASVLNLSKCSSLNVSDDH 217
                            |.:.|||||:|.:..|             ||..||.:.  .|::..||.
  Fly   174 LLHPALHATEEHKYCANTSINNNNNNNDVHNG-------------ESMEVLEMK--YSISEKDDE 223

  Fly   218 YYCDYYVKPELDLSVGGGAGSSTSGSSS----GGGPLPLPAHQAHNDSRVSSTRNEQRAQ----- 273
            ...|.: .|.:..::|....|||...||    |||..|..:..|..||..:...:.|.|:     
  Fly   224 ETIDAF-DPAVTNTLGMNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQL 287

  Fly   274 -----------------------------HH--SYEDMDDSSIRSGDEDIAH-----------AS 296
                                         ||  |||......|::..|..:.           :|
  Fly   288 IYSDGGHGTPPPLHYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECEATSTMTNAGSIYGGLSS 352

  Fly   297 DVVEELDAIDADFPYPLILDSNSRGSPNVG----VDDVVMSRKLRRNVDQDVLEEG------NGH 351
            ..|.:::...:..|....|....|....:|    :||||     .|...||....|      ||.
  Fly   353 SEVADMEFFRSILPDLATLTPQQRRKFKIGILELIDDVV-----TRYPAQDHSNGGGVSGVVNGS 412

  Fly   352 GDAVIDGDDYEEQMLQQHRHLRQQ 375
            |.: .:|...:.|.....|..|:|
  Fly   413 GGS-SNGGSVKHQRRSSGRDWRKQ 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 19/89 (21%)
brwlNP_609298.1 MADF 60..145 CDD:214738 19/89 (21%)
BESS 356..389 CDD:281011 4/32 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.