DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and Hmr

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_572637.2 Gene:Hmr / 31988 FlyBaseID:FBgn0001206 Length:1413 Species:Drosophila melanogaster


Alignment Length:152 Identity:36/152 - (23%)
Similarity:64/152 - (42%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSGCLPTATHSLQDMSAAAAAIALDMKPKLEPHPLAAATAMPSQKIKKLVRRNASDKLKLIQMVH 68
            ||..:...|:.:.|..|              |:|.:..| .|..:...:::...:::| ||.:|.
  Fly    16 VSDTIGQKTNGVDDDKA--------------PNPFSRCT-YPGSRDGGILQTYRAERL-LIALVR 64

  Fly    69 DNPILWDSRLPNFKG-AEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELAHVKLMGNGFK 132
            ..|:|:|:|.|.|:. |:.||.  |:.|............|::.:||..|:|   ||:.:.|   
  Fly    65 RQPLLYDARHPKFRDVAQREKQ--WKKIASRLATNATNCKRSWSALRYKYQR---HVRRLRN--- 121

  Fly   133 PKWSLYEAMDFLRDVIRERKGA 154
                      |.|..|::.:.|
  Fly   122 ----------FHRSAIQKDRAA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 24/87 (28%)
HmrNP_572637.2 MADF_DNA_bdg 59..149 CDD:287510 26/93 (28%)
GT1 213..295 CDD:304916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.