DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and madf-4

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:313 Identity:69/313 - (22%)
Similarity:117/313 - (37%) Gaps:77/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRV--ARAFKSLRESYRR---- 119
            |.||..|..||.:::...|..| ..:.|:..|:.|..|....|:.|  .|.:|.:|:.|.|    
 Worm    20 LALIDSVQRNPCVYNRYDPLHK-VTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDKYVRLRKQ 83

  Fly   120 --ELAHVKLMGNGFKPKW-SLYEAMDFLRDVIRERKGASHATDLSLTTYGHINNNNNNNNNSNSL 181
              :.|.:|...     || :.|..|.|| |...|.:......|       ::|:|..:       
 Worm    84 DKQKAPIKKTN-----KWYNYYHKMSFL-DPYVEHRNRKRQKD-------YLNSNTPD------- 128

  Fly   182 AAGGKAMTLKLSNSFNESASVLNLSKCSSLNVSDDHYYCDYYVKPELDLSVGGGAGSSTSGSSSG 246
                   .|....:|.:..||..:.|..||..|:|..|...:..          :.||:|||::.
 Worm   129 -------FLDDDTAFLDGLSVKEMLKPESLLTSNDAGYNSPHTT----------SSSSSSGSNNN 176

  Fly   247 GGPLPLPAHQAHNDSR----------VSSTRNEQRAQHHSYEDMDDSSIRSGDEDIAHASDVVEE 301
            |..|..|.....:|.:          .:.|.||   ::|.:      |.:.|.:.:...::.:.|
 Worm   177 GRFLDSPTIDIEDDKKNLALIYDKFVANQTENE---KNHRF------SNKHGKDLLFSTTNTLIE 232

  Fly   302 LDAIDADFPYPLILDSNSRGSPNVGVDDVVMS-----RKLRRNVDQDVLEEGN 349
            ..|..:..|      |:||....:.|..:..|     :..:..:.:|:|.|.|
 Worm   233 KLATTSTAP------SSSRKRKPIPVQILPSSPPPQEKNTKIELLEDILNEPN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 27/95 (28%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.