DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mes2 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:232 Identity:53/232 - (22%)
Similarity:92/232 - (39%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELAHVKL 126
            ||||.|:..|:|::..|.::: :.|.:.:||..:............|.:|::|:.|.||....||
Zfish     8 KLIQTVYAFPVLYNVSLHDYR-STERRVKAWREVAASVGLSVVECKRRWKTIRDRYIRERRLCKL 71

  Fly   127 ---MGNGFKPKWSLYEAMDFLRDVIRERKGASHATDLSLTTYGHINNNNNNNNNSNSLAAGGKAM 188
               :|......|...|::.||...||:|:..|.|..        ........::|.:|....:.:
Zfish    72 KKDLGGRRLHYWPHRESLAFLDAHIRKRRRPSGAQG--------PEEEQQEEHSSAALQEDKECV 128

  Fly   189 TLKLSNSFNESA------SVLNLSKCSSLNVSDDHYYCDYYVKPELDLSVGGG-----AGSSTSG 242
            :.:..:|.:..|      |:::......|.....       |.|.|..::..|     ..||.:|
Zfish   129 SEECVDSGSRLAVSPLPVSIMSAPPPPQLKAVPQ-------VSPLLLAALPPGLKVAPVCSSATG 186

  Fly   243 SSSGGGPLPLPAHQAHNDSRVSSTRNEQRAQHHSYED 279
            |:| .|||.:|..:            :|||.....||
Zfish   187 SAS-AGPLNVPLEE------------QQRADGALDED 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mes2NP_730768.1 MADF 62..149 CDD:214738 24/89 (27%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 24/89 (27%)
BESS 208..242 CDD:281011 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.