DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and zgc:152938

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:234 Identity:52/234 - (22%)
Similarity:97/234 - (41%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEKML 77
            ||.||.....|:|.....||..|||:|: |.|:......:.:.|:..:.:||:.:.|:...::..
Zfish    60 LISLVSDRRELFDQNHIDYKHIDKREAL-WQEIAEKIGFHVDDVKTKWKNLRDTYIRKKREDQCT 123

  Fly    78 G--TTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSRNS------ 134
            |  |.:.|..|::...|.||.....:|:....:|. |.|.  |..||.:..:..:|..|      
Zfish   124 GEQTPKKKKTWKFMKMMEFLATSSEQRRVHSSVKE-SADE--VGDGSESEKSLSISVESAVSSEP 185

  Fly   135 ----SNNNSSSAALDEYQ-YFAPSDPNNPNNQPQLQPEPKSSLPVTIPSLSLTLSQLPVALQQQA 194
                |.....|...|..: |.|..:..:...:...:...:..:.:.:.||:..:.:||.: :|.:
Zfish   186 VQANSKKRKRSVTPDFVEKYLAAKEVRDREREECRKQRMEDDISLFLMSLAPVIRRLPPS-KQSS 249

  Fly   195 QHLQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSP 233
            ..::..|:..:|..          .|::|:..|.||..|
Zfish   250 VKMRFHQVLHEVEY----------GLSDASQPPSAQHCP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 25/88 (28%)
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 19/68 (28%)
BESS 226..260 CDD:281011 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.