DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and Adf1

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:218 Identity:53/218 - (24%)
Similarity:92/218 - (42%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NIEKR---RLIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFR 68
            |:|::   .|||.|:|||:::|....:||.. .|||..|.::.....|..::..:.:.|||:.|.
  Fly     7 NLEQQFDLNLIEAVKLNPVIYDRSHYNYKHF-VRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFA 70

  Fly    69 RELNHEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSR--ERIKHGSLDSAPVA------------ 119
            ||:   |:..    :|:|.|:..|.||.:.||:.:..  .:..:||..:..||            
  Fly    71 REM---KLCQ----ESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQT 128

  Fly   120 ---------TGSSNNNNNCVSRNSSNNNSSSAAL------DEYQYFAPSDPNNPNNQPQLQPEPK 169
                     .||:..:...::.......:|.|.|      |:..||  .:|  |..:.:.:.|..
  Fly   129 VVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYF--YEP--PLKRERSEEEHS 189

  Fly   170 SSLPVTIPSLSLTLSQLPVALQQ 192
            .::..||......:||...|..|
  Fly   190 DNMLNTIKIFQNNVSQAVSAEDQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 28/87 (32%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.