DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and CG11504

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:368 Identity:76/368 - (20%)
Similarity:136/368 - (36%) Gaps:81/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLF--NVNGERVQRTFTSLREIFRRELNHE 74
            :||...|....|||.....|::.|.::.: .||:.::.  |:....:::.|.:||..:.||::  
  Fly    10 QLISEYRSRRGLWDMTCDEYRKKDVKQRL-LNEVSQVLGGNIPINELEKKFHTLRTQYHREIS-- 71

  Fly    75 KMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIK------------------HGSLDSAPVATG 121
            :|.....:.|||..:..:.||......|.::.|:|                  |.| ||:..|..
  Fly    72 RMKRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNS-DSSTPANH 135

  Fly   122 SSNNNNNCVSRNSSNNNSSSAALDEYQYFAPS----DPNNPNNQPQLQPEPKSSLPVTIPSLSLT 182
            :||.|.|........|::||.|.:..:....:    |..:.:...:.:.:||.:..:::..:||.
  Fly   136 NSNTNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVSLN 200

  Fly   183 LSQLPVALQQQAQHLQALQLQPD-VTLTSLQK--------QSLPTSLTNATPAPLAQTSPAQVLS 238
            ..:....|:...|.|..|..|.: |...|.|.        |:.||..|.::.   ....|.:::.
  Fly   201 EQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGELHYQTTPTQSTGSSS---VHVMPTRIIK 262

  Fly   239 SSRSCSSS---------------PSI---YIKDEPC-------------SPAGGCPEEVMTGNGP 272
            ..|..:||               |.:   |.:..|.             |.|.|....|:| ..|
  Fly   263 IQRRDTSSGQEDSYFEEHTQLHPPPVKRMYYEASPASHNTTSILSPALESSANGTASSVLT-TSP 326

  Fly   273 EATRKKLATIRPQTKQQLKARLQLPTPKNSSSYATSPPHLIIN 315
            ..|...|...:..|.         |.|..:.:..:.||..|::
  Fly   327 GITMSNLRLPKVNTP---------PKPAQAQAIPSPPPPTIVS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 22/89 (25%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 20/83 (24%)
CytochromB561_N 238..>409 CDD:286826 25/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.