DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and jigr1

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:101/269 - (37%) Gaps:79/269 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIELVRLNPILWDCRLPHYKRSDKRKAIK------WNELGRLFNVNGERVQRTFTSLREIFRREL 71
            ||...|.:|:|:|       ||:||...|      |.::......:...::...|:||..:    
  Fly    33 LIREYRSHPVLYD-------RSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRY---- 86

  Fly    72 NHEKML---GTTRFKSKWEYYDAMAFLKEVIRERKSRERI------------------KHGSLDS 115
            |.||..   |.:...|:|..::::.||.:.||.|:|.:.:                  .:|.::|
  Fly    87 NIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNS 151

  Fly   116 -----------------APVAT--GSSNNNNNCVSRNSSNNNSSSAALDEYQYFAPSDPNNPNNQ 161
                             .||.|  |...||::..:::..:.|........|.:||.|    .:.:
  Fly   152 IKDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAES----YHRR 212

  Fly   162 PQLQPEPKSSLPVTIPSLSLTLSQLPVALQQQAQHLQALQLQPDVTLTSLQKQSLPTSLTNATPA 226
            .|.|||...|.|:..|..|         .::.:|||..   .|     |.::.....|::...|.
  Fly   213 HQNQPEYIISSPIVNPMRS---------NKRGSQHLDD---HP-----SKRRVDDSLSISGYYPT 260

  Fly   227 -PLAQTSPA 234
             |||...||
  Fly   261 QPLAPLPPA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 23/95 (24%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.