DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and hng2

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:206 Identity:49/206 - (23%)
Similarity:72/206 - (34%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IELVRLNPILWDCRLPHYKRSDKRKAIKWNELGR----LFNVNGE-------------------- 54
            |:.|....|:|:...|::...:.|.. .|.::|.    .|:.:.|                    
  Fly    22 IDAVHKRSIIWERSHPNFHNRELRDE-AWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDS 85

  Fly    55 --RVQRTFTSLREIFRRELNHEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSA- 116
              ||.|...|..|:.|....:||.| :.....|.|..|.:..|||..:.:..|:|:...:..|| 
  Fly    86 YLRVNRLRQSGEEVARASYIYEKEL-SFLLNVKAESEDDVESLKEQPKPQAKRKRVSTAAQRSAK 149

  Fly   117 -PVATGSSNNNN-NCVSRN---SSNNNS---------SSAALDEYQYF--APSDPNNPNNQPQLQ 165
             |....|...:| ....||   .||.|:         ...|..|..|.  .||||....|...|.
  Fly   150 TPRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAYIPQLPSDPPCSTNTAYLS 214

  Fly   166 PEPKSSLPVTI 176
            .:|..:...||
  Fly   215 ADPDQAFFDTI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 25/111 (23%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 19/92 (21%)
BESS 216..250 CDD:281011 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.