DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and CG3919

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:327 Identity:63/327 - (19%)
Similarity:123/327 - (37%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLIELVRLNPILWDCRLPHYKRSDKRKAIK--WNELGRLFNVNGERVQRTFTSLREIFRRELNHE 74
            ::..||:|:|.|:|....:|.|   :..:|  |.|:......:.:..:..:.::|..:.|.:...
  Fly    20 KICHLVKLHPCLYDRHDDNYLR---KSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLH 81

  Fly    75 KMLGTTRFKSKWEYY--DAMAFLKEVI--------RERKSRERIKHGSLDSAP----------VA 119
            ....|        ||  ..:.||::.|        |.|:||.:.:....:..|          |.
  Fly    82 HGANT--------YYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVH 138

  Fly   120 TGSSNNNNNCVSRNSSN------------NNSSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSL 172
            :.|..|:.:..||:|::            ||..|:.:| ::...|::....::..:.:.:.....
  Fly   139 SPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMD-FEDTVPAEMRTESDSSEKEAKVGEIT 202

  Fly   173 PVTIPSLSL------TLSQLPVALQQQAQHLQALQLQPDVT-LTSLQKQSLPTSLTNATPAPLAQ 230
            ...:|.|..      .:..||: :......||.  |:|::. :...||......:.:..      
  Fly   203 LYRVPLLEFPKTSTRCIEALPI-MDFDDAFLQG--LRPEIKHMNFHQKLYFKRRVYDLL------ 258

  Fly   231 TSPAQVLSSSRSCSSSPSIYIKDEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQQLKARLQ 295
               .::..|.:|.||:          .||...|.|.:  ||..:|...|::..|  .|.:...||
  Fly   259 ---GEIFHSEQSASST----------HPAQPHPRENV--NGTLSTTSSLSSANP--LQHMGLMLQ 306

  Fly   296 LP 297
            ||
  Fly   307 LP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 19/99 (19%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 18/90 (20%)
BESS 226..260 CDD:281011 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.