DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and hng1

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:301 Identity:61/301 - (20%)
Similarity:110/301 - (36%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEKML 77
            ||:.:|..|.|:|.:||.::.| :||...|.::..|.|::....:|.:|.||:.:.|||..:::.
  Fly    15 LIQTIRETPSLYDPQLPSFRLS-QRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKRLH 78

  Fly    78 GTTRFKSKWEYYDAMAFLKEVI---RERKSRER-------------IKHGSLDSAPVATGS--SN 124
            .:..|... :::..|.||::.:   |||:.|||             ::.......|:.|.:  ..
  Fly    79 PSGEFGHN-DFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLPIDTETLIEE 142

  Fly   125 NNNNCVSRNSSNNN------SSSAALDEYQYFAPSDPNNPNNQ---------------------- 161
            ..::........::      |.:...:.|.....:|......|                      
  Fly   143 QGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESFDEFLGDAECEQKVKVVTIH 207

  Fly   162 PQLQPEPKSSLPVTIPSLSLTLSQL---PVALQQQAQHLQALQLQPDVTLTSLQKQSLPTSLTNA 223
            |::.....:|.|..|.|....|:.|   |....|:.:|.......|...:|....::.......:
  Fly   208 PEIAAPNATSAPEPIESNHADLNYLVCMPPNANQEREHSAPELPNPTAVITQKTCETEDDFFCKS 272

  Fly   224 TPAPLAQTSPAQVLSSSRSCSSSPSIYIKDEPC---SPAGG 261
            ..|.|.|.|....:.:..........||..|.|   |.|||
  Fly   273 IAAYLRQLSRVHKIKAKVEMYQILEKYILLEECGKGSGAGG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 25/89 (28%)
hng1NP_611558.2 MADF 15..98 CDD:214738 25/84 (30%)
BESS 264..298 CDD:281011 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.