DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and CG7745

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:445 Identity:92/445 - (20%)
Similarity:142/445 - (31%) Gaps:135/445 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSR-NSSNNNSSSAALDEYQYFA 151
            |.:.|.||.:.|:.|||...:.  :..::|.:..||..|...|.: |.|..|.|.        |.
  Fly    84 YLEKMKFLDQHIQPRKSYRHVP--NFLTSPQSANSSGYNEYQVDKSNGSMKNVSQ--------FG 138

  Fly   152 PSDPNNPNNQPQLQPEPKSSLPVTIPSLSLTLSQLPV------------ALQQQAQHLQALQLQP 204
            .|..::..:||..|....:...|...:|.....|:.:            ...||.||:...|:|.
  Fly   139 SSGQSHLYHQPDQQHAMSALSNVAASALENVNGQVKIEADQVFRDFAAAVASQQLQHISQSQMQQ 203

  Fly   205 DVTLTS---------LQKQSLPTSL-TNATPAPLAQTSPAQVLSSSRSCSSSPSIYIKDEPCSPA 259
            .....:         .|.|....|: .|.     ||.|...:.|:|.|..|..|        || 
  Fly   204 QAAAVAAVMADSSQGYQDQYKDGSVGMNG-----AQNSAGSLTSTSSSMKSPLS--------SP- 254

  Fly   260 GGCPEEVMTGNGPEATRKKLATIRPQTKQQLKARLQLP--------------------------- 297
                   :.|.|..:...:..|.:.|.:||.:|:.|.|                           
  Fly   255 -------LQGIGAGSHHPQQQTQQQQQQQQQQAQQQSPASEQQLPVVHSSSSATGASIGNSSTLQ 312

  Fly   298 -------TPK-------NSSSYATSPPHLIINAN-NELIDTDAGDLEEDLDDFDEDDDVTGRCSP 347
                   .||       :||.:....|.:.:|.| :..:.::......|.|| :.|::......|
  Fly   313 MQQSHVYNPKGDGLDSSSSSHFHMKKPRIQLNGNAHNQMTSNGSHFGNDSDD-ESDENSHDLMEP 376

  Fly   348 -IVGQSET--------MGADGRLSVGSIYIGDGGDCGRGMGRAHTQARH---VPTSRELLYM--- 397
             .:.|.|.        ...:|..:..|...|.....|........|.:|   .|::.:.|:.   
  Fly   377 QAMMQQENHYSNSMPMQRGNGNGNNSSSNSGSNNPSGNNSHNNQQQQQHQNMFPSNTDFLFQLYQ 441

  Fly   398 ------------KFGDFLA-------ARL--NTLHETVANEL--MNKMLLLIAEK 429
                        .||.|.|       .||  :.|.|.|..||  |||.....|:|
  Fly   442 QFPHQASSSHPANFGKFQAPPNHPGVQRLSEHLLGELVTTELLKMNKERKKSAQK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 4/11 (36%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.