DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12768 and CG30403

DIOPT Version :9

Sequence 1:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster


Alignment Length:278 Identity:51/278 - (18%)
Similarity:93/278 - (33%) Gaps:101/278 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFT---------SLREIF 67
            :.:||....|.||:.| |:.:|:   ::..:..:....|.:.|..:...|         :||..:
  Fly    23 KFVELYGREPCLWNKR-PYLRRA---RSAAYRRIQSGINADIEPYESGLTIQGVKMKIKNLRTGY 83

  Fly    68 RRELNHEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSR 132
            .:||...:.:...:.|:.| :.....||.|.:                                 
  Fly    84 HQELKKIRTIPGYQPKTPW-FAPLHGFLAEFL--------------------------------- 114

  Fly   133 NSSNNNSSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSLSLTLSQL-PVALQQQAQH 196
                                 |.|          |.::|:| .:..|.:.|::| |:.:|     
  Fly   115 ---------------------DTN----------ELETSIP-QLKRLQIRLTRLKPIKIQ----- 142

  Fly   197 LQALQLQPDVTLTSLQKQSL---PTSLTNATPAPLAQTSPAQVLSSSRSCSSSPSIYIKDEPCSP 258
               .:::||....|:..:.|   |:||....|||:....|.         :..||:....:..||
  Fly   143 ---TEIKPDPDDLSVPDRPLDATPSSLFTVLPAPMPVEEPP---------TPPPSVPKIGDIISP 195

  Fly   259 AGGCPEEV-MTGNGPEAT 275
            ....|..| :.||.|.:|
  Fly   196 VHPDPAPVPIAGNCPLST 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 20/96 (21%)
CG30403NP_726108.3 GT1 24..103 CDD:304916 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.