DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and Ddx43

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:XP_003750593.1 Gene:Ddx43 / 682138 RGDID:1586947 Length:646 Species:Rattus norvegicus


Alignment Length:465 Identity:91/465 - (19%)
Similarity:184/465 - (39%) Gaps:52/465 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DSYSGQNANRPLVATNCSEYAVAHANCQLRPVRRFAEV-SLLPDILETMRNLGLNRLLRLQSYTW 85
            |::..:|.|     ..|.:...........|:.:|.:. ...|:::|.::..|..:...:||..|
  Rat   212 DNWRKENFN-----ITCDDLKDGEKRPIPNPICKFEDAFHSYPEVMENIKRAGFQKPTPIQSQAW 271

  Fly    86 PHLAGGSGHGAMIVGSPASGRTFAYI-PPVCHAVSRALMDFTGQCEDVEHDISQPDRYGPIALIL 149
            |.:.  .|...:.|....:|:|.:|: |...|..|:.|              ::..|.||..|:|
  Rat   272 PIVL--QGIDLIGVAQTGTGKTLSYLMPGFIHLDSQPL--------------AREQRNGPGMLVL 320

  Fly   150 VPDLRRVHQVSAMCLALLRKAHKNDSVTLALNVSSTKSSQFFLKLLNGVGCLVATPAQLVWFWQE 214
            .|......||.|.|    .|....|..::.:.....:..| ...:..||..::|||.:|...  :
  Rat   321 TPTRELALQVEAEC----SKYSYGDLKSVCVYGGGDRDGQ-IQDVSKGVDIIIATPGRLNDL--Q 378

  Fly   215 APGLMRFPCLQFLVYDDVDLMSREQLQDVQQVLQEILPLSHSPQVVMVSKSYCHTLMSKLRAVND 279
            ....:....:.:||.|:.|.|.....:  .|:::.:|.:....|.:|.|.::.:.:....::...
  Rat   379 MNNFVNLKSVTYLVLDEADKMLDMGFE--PQIMKILLDVRPDRQTIMTSATWPYAVRRLAQSYLK 441

  Fly   280 KPALVFGDILEAALYGGTRIRISIMRSEAKANAVVQMLQQCSPEEFRTVIFCSDDGDMQCLVAAL 344
            :|.:|:...|:.......:..|.|...|.|...:...|:..||:: :.::|.|.......|.:.|
  Rat   442 EPMIVYVGTLDLVAVSTVKQNIIITTEEEKRTHIQTFLENMSPKD-KVIVFVSRKAVADHLSSDL 505

  Fly   345 EVQHYSCLPYYQTADLEVRQQVHSWQARSNGVILLCTDNCPE-LDIRDAHTIIHHSMSHSWSKFK 408
            .::|.|....:...:...|::...........||:.||.... ||:.|...:.::....:..::.
  Rat   506 ILRHISVESLHGNREQSDREKALENFKTGKVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYV 570

  Fly   409 LRHLKISDNLCNMVKPTASIVKKPLYSLVLLDDNNHRQLPRLVDFLQ-LHQKVDHRLVEVAKR-- 470
            .|           |..|....:..: |:.|:..|:.|....|::.|: .:|.:...||.:|:|  
  Rat   571 HR-----------VGRTGRAGRTGM-SITLITRNDWRIATELINILERANQNIPEELVLMAERYK 623

  Fly   471 ---IRQELGK 477
               :::|:.|
  Rat   624 ANKLKREMEK 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 41/182 (23%)
Ddx43XP_003750593.1 KH-I 68..133 CDD:412160
PTZ00110 153..642 CDD:240273 91/465 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.