DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and CG10333

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster


Alignment Length:398 Identity:83/398 - (20%)
Similarity:151/398 - (37%) Gaps:93/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PVRRFAEVSLLPDILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIVGSPASGRTFAYIPPVCH 116
            |:|.:.|.....:|::.:..:|......:|....|  .|......:.|....||:|.|::.|   
  Fly   392 PIRSWNESGFPKEIIDIIDKVGYKEPTPIQRQAIP--IGLQNRDIIGVAETGSGKTLAFLIP--- 451

  Fly   117 AVSRALMDFTGQCEDVE--HDISQPDRYGPIALILVPDLRRVHQVS------AMCLALLRKAHKN 173
                 |:.:......:|  .|:.|    ||.|:|:.|......|:.      ...|.:       
  Fly   452 -----LLSWIQSLPKIERLEDVDQ----GPYAIIMAPTRELAQQIEEETTKFGQPLGI------- 500

  Fly   174 DSVTLALNVSSTKSSQFFLKLLNGVGC--LVATPAQLVWFWQEAPGLMRFPCLQ---FLVYDDVD 233
             ...:.:...|.:...|.|:|    ||  ::|||.:|:...:.     |:..|.   ::|.|:.|
  Fly   501 -RTVVVVGGLSREEQGFRLRL----GCEIVIATPGRLIDVLEN-----RYLVLNQCTYIVLDEAD 555

  Fly   234 LMSREQLQ-DVQQVLQEILPLSH-SPQV------------VMVSKSYCHTLM---------SKL- 274
            .|.....: |||::| |.:|::: .|..            ....|.|..|:|         .:| 
  Fly   556 RMIDMGFEPDVQKIL-EYMPVTNLKPDTEEAEDETKLMENFYTKKKYRQTVMFTATMPPAVERLA 619

  Fly   275 RAVNDKPALVF-GDI------LEAALYGGTRIRISIMRSEAKANAVVQML-QQCSPEEFRTVIFC 331
            |....:||.|: |.:      .|..:|        :|....|...::::| ::..|.   .:||.
  Fly   620 RTYLRRPATVYIGSVGKPTERTEQIVY--------MMGENDKRKKLMEILSRKIDPP---VIIFV 673

  Fly   332 SDDGDMQCLVAALEVQHYSCLPYYQTADLEVRQQVHSWQARSNGV--ILLCTDNCPE-LDIRDAH 393
            :.......|...||...|:....:.....|.|:  ::..|..:|.  ||:.||.... :||:|..
  Fly   674 NQKKGADVLAKGLEKLGYNSCTLHGGKGQEQRE--YALAALKSGAKDILVATDVAGRGIDIKDVS 736

  Fly   394 TIIHHSMS 401
            .:|::.|:
  Fly   737 LVINYDMA 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 43/208 (21%)
CG10333NP_609888.2 DEADc 396..629 CDD:238167 54/264 (20%)
DEXDc 409..632 CDD:214692 53/254 (21%)
Helicase_C 651..761 CDD:278689 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.