DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and Ddx23

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001100263.2 Gene:Ddx23 / 300208 RGDID:1308685 Length:819 Species:Rattus norvegicus


Alignment Length:387 Identity:87/387 - (22%)
Similarity:158/387 - (40%) Gaps:70/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PVRRFAEVSLLPDILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIVGSPASGRTFAYIPPVCH 116
            |:|.:.:.||.|.|||.:...|......:|....|  .|......:.|....||:|.|::.|   
  Rat   388 PIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIP--IGLQNRDIIGVAETGSGKTAAFLIP--- 447

  Fly   117 AVSRALMDFTGQCEDVEHDISQPDRYGPIALILVPDLRRVHQVSAMCLALLRKAHKNDSV-TLAL 180
                 |:.:......::. |.:.|: ||.|:||.|......|:....:    |..|...: |:|:
  Rat   448 -----LLVWITTLPKIDR-IEESDQ-GPYAIILAPTRELAQQIEEETI----KFGKPLGIRTVAV 501

  Fly   181 NVSSTKSSQFFLKLLNGVGCLVATPAQLVWFWQEAPGLMRFPCLQ---FLVYDDVDLMSREQLQ- 241
            ....::..|.| :|..|...::|||.:|:...:.     |:..|.   ::|.|:.|.|.....: 
  Rat   502 IGGISREDQGF-RLRMGCEIVIATPGRLIDVLEN-----RYLVLSRCTYVVLDEADRMIDMGFEP 560

  Fly   242 DVQQVLQEILPLSH---------SPQVVMVS-----KSYCHTLM--------------SKLRAVN 278
            |||::| |.:|:|:         .|:.::.:     ..|..|:|              |.||   
  Rat   561 DVQKIL-EHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLR--- 621

  Fly   279 DKPALVFGDILEAALYGGTRI--RISIMRSEAKANAVVQMLQQ-CSPEEFRTVIFCSDDGDMQCL 340
             :||:|:   :.:|.....|:  ::.:|....|...::.:|:| ..|.   .:||.:.......|
  Rat   622 -RPAVVY---IGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPP---IIIFVNQKKGCDVL 679

  Fly   341 VAALEVQHYSCLPYYQTADLEVRQQVHSWQARSNGVILLCTDNCPE-LDIRDAHTIIHHSMS 401
            ..:||...|:....:.....|.|:...|........||:.||.... :||:|...::::.|:
  Rat   680 AKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMA 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 45/195 (23%)
Ddx23NP_001100263.2 SF-CC1 79..>207 CDD:273721
DEADc_DDX23 401..627 CDD:350703 57/252 (23%)
SF2_C_DEAD 638..767 CDD:350174 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.