DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and Ddx5

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001007614.1 Gene:Ddx5 / 287765 RGDID:619906 Length:615 Species:Rattus norvegicus


Alignment Length:475 Identity:94/475 - (19%)
Similarity:174/475 - (36%) Gaps:106/475 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EYAVAHANCQLRPVRRFAEVSLLPDILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIVGSPAS 104
            |..|...||. :||..|.|.:...::::.:..........:|:..||  ...||...:.|....|
  Rat    81 EITVRGHNCP-KPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWP--VALSGLDMVGVAQTGS 142

  Fly   105 GRTFAY-IPPVCHAVSRALMDFTGQCEDVEHD--ISQPDRYGPIALILVPD---LRRVHQVSA-M 162
            |:|.:| :|.:.|               :.|.  :.:.|  |||.|:|.|.   .::|.||:| .
  Rat   143 GKTLSYLLPAIVH---------------INHQPFLERGD--GPICLVLAPTRELAQQVQQVAAEY 190

  Fly   163 CLALLRKAHKNDSVTLALNVSSTKSSQFFLKLLNGVGCLVATPAQLVWFWQEAPGLMRFPCLQFL 227
            |.|...|       :..:...:.|..| ...|..||...:|||.:|:.|.:  .|........:|
  Rat   191 CRACRLK-------STCIYGGAPKGPQ-IRDLERGVEICIATPGRLIDFLE--CGKTNLRRTTYL 245

  Fly   228 VYDDVDLMSREQLQDVQQVLQEILPLSHSPQVVMVSKSYCHTLMSKLRAVNDKPALVFG------ 286
            |.|:.|.|               |.:...||:        ..::.::|.  |:..|::.      
  Rat   246 VLDEADRM---------------LDMGFEPQI--------RKIVDQIRP--DRQTLMWSATWPKE 285

  Fly   287 --DILEAALYGGTRIRISIMRSEAKANAVVQMLQQC-----------------SPEEFRTVIFCS 332
              .:.|..|.....|.|..:...|..| ::|::..|                 |.:|.:|::|..
  Rat   286 VRQLAEDFLKDYIHINIGALELSANHN-ILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVE 349

  Fly   333 DDGDMQCLVAALEVQHYSCLPYYQTADLEVRQQVHSWQARSNGVILLCTDNCPE-LDIRDAHTII 396
            .......|...:....:..:..:.....:.|..|.:........||:.||.... ||:.|...:|
  Rat   350 TKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVI 414

  Fly   397 HHSMSHSWSKFKLRHLKISDNLCNMVKPTASIVKKPLYSLVLLDDNNHRQLPRLVDFL-QLHQKV 460
            ::...:|           |::..:.:..||...|... :......||.:|:..|:..| :.:|.:
  Rat   415 NYDYPNS-----------SEDYIHRIGRTARSTKTGT-AYTFFTPNNIKQVSDLISVLREANQAI 467

  Fly   461 DHRLVEVAKRIRQELGKARN 480
            :.:|:::.    ::.|..|:
  Rat   468 NPKLLQLV----EDRGSGRS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 46/188 (24%)
Ddx5NP_001007614.1 PTZ00110 6..507 CDD:240273 94/475 (20%)
P68HR 498..532 CDD:400414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.