DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and dbp3

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_596388.1 Gene:dbp3 / 2540213 PomBaseID:SPBC17D1.06 Length:578 Species:Schizosaccharomyces pombe


Alignment Length:291 Identity:60/291 - (20%)
Similarity:109/291 - (37%) Gaps:69/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LRPVRRFAEVSLLPDILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIVGSPASGRTFAY-IPP 113
            |.|:.:|.|:.:...:.|.::|  ......:|:.|||:|.  :|...:.:....||:|.|: || 
pombe   163 LLPILQFDELDVSAKLREGLKN--YKEPTPIQAATWPYLL--AGRDVVGIAETGSGKTVAFGIP- 222

  Fly   114 VCHAVSRALMDFTGQCEDVEHDISQPDRYGPIALILVPDLRRVHQVSAMCLALLRKAHKNDSVTL 178
                   ||....|..:         ::..|..|::.|......|......:|::..:....|..
pombe   223 -------ALQYLNGLSD---------NKSVPRVLVVSPTRELAIQTYENLNSLIQGTNLKAVVVY 271

  Fly   179 ALNVSSTKSSQFFLKLLNGVGCLVATPAQLVWFWQEAPGLMRFPCLQ--FLVYDDVDLMSREQL- 240
            .   .:.||.|  .:.......::.||.:|:....:.    ...|.|  :||.|:.|.|..... 
pombe   272 G---GAPKSEQ--ARAAKNASVIIGTPGRLLDLINDG----SIDCSQVGYLVLDEADRMLDTGFE 327

  Fly   241 QDVQQVLQEILPLSHSP--------QVVMVSKSYCHTLMSKLRAVNDKPALVFGDILEAALYGGT 297
            ||::.:      :||:|        |.|..|.    |....:||:             ||.:...
pombe   328 QDIRNI------ISHTPDPTRNGSRQTVFFSA----TWPESVRAL-------------AATFLKD 369

  Fly   298 RIRISIMRSEAKAN----AVVQMLQQCSPEE 324
            .::|:|...|..|:    .:|::|.....:|
pombe   370 PVKITIGSDELAASQNITQIVEILDDPRSKE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 41/193 (21%)
dbp3NP_596388.1 PTZ00424 169..549 CDD:185609 58/285 (20%)
DEADc 169..374 CDD:238167 51/257 (20%)
HELICc 385..519 CDD:238034 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.