DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and Y54G11A.3

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_496973.1 Gene:Y54G11A.3 / 175083 WormBaseID:WBGene00013214 Length:504 Species:Caenorhabditis elegans


Alignment Length:293 Identity:62/293 - (21%)
Similarity:112/293 - (38%) Gaps:44/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KISDEK-TWQSSRDSVYEVGDSYSGQNANRPLVATNCSEYAVAHANCQLRPVRRFAEVSLLP--- 63
            ::.||. :|...     .|.|.|...|..:.|......|........::.|.|..:.|.:.|   
 Worm    24 RLKDENFSWMKP-----IVRDLYKIPNEQKNLSPEQLQELYTNGGVMKVYPFREESTVKIPPPVN 83

  Fly    64 ----------DILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIVGSPASGRTFAYIPPVCHAV 118
                      .|:..:|..|..:...:||..||.|.  ||...:.|....||:|.|::.|     
 Worm    84 SFEQAFGSNASIMGEIRKNGFEKPSPIQSQMWPLLL--SGQDCIGVSQTGSGKTLAFLLP----- 141

  Fly   119 SRALMDFTGQCEDVEHDISQPDRYGPIALILVPDLRRVHQVSAMCLALLRKAHKNDSVTLALNVS 183
              ||:....|....|.: .:..:..|..|:|.|......|:...    ::|...|...::.|...
 Worm   142 --ALLHIDAQLAQYEKN-DEEQKPSPFVLVLSPTRELAQQIEGE----VKKYSYNGYKSVCLYGG 199

  Fly   184 STKSSQFFLKLLNGVGCLVATPAQLVWFWQEAPGLMRFPCLQFLVYDDVDLMSREQLQ-DVQQVL 247
            .::..| ......||..::|||.:|.....:  |::....:.::|.|:.|.|.....: .::::|
 Worm   200 GSRPEQ-VEACRGGVEIVIATPGRLTDLSND--GVISLASVTYVVLDEADRMLDMGFEVAIRRIL 261

  Fly   248 QEILPLSHSPQVVMVSKSYCHTLMSKLRAVNDK 280
            .||.|    .::|.::.:   |....:|.:.||
 Worm   262 FEIRP----DRLVALTSA---TWPEGVRKLTDK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 42/182 (23%)
Y54G11A.3NP_496973.1 DEADc 94..293 CDD:238167 49/218 (22%)
DEXDc 99..311 CDD:214692 48/213 (23%)
HELICc 308..441 CDD:238034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.