DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BoYb and AgaP_AGAP011520

DIOPT Version :9

Sequence 1:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster
Sequence 2:XP_307211.3 Gene:AgaP_AGAP011520 / 1268649 VectorBaseID:AGAP011520 Length:98 Species:Anopheles gambiae


Alignment Length:58 Identity:17/58 - (29%)
Similarity:21/58 - (36%) Gaps:14/58 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 GKARNDQHQLCDQILVLGKCYDPVCESRHRLSHIDRRPDYLPASGDVKVQLVKVYSPT 533
            |..:..|.||.|.|       |..||..:....|..   |.|..|:|    |..|.|:
Mosquito    38 GSRKKQQKQLQDAI-------DEYCEQHYLNQSIGH---YEPVFGEV----VAFYDPS 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359
AgaP_AGAP011520XP_307211.3 TUDOR 12..>98 CDD:278965 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9704
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13811
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.