powered by:
Protein Alignment BoYb and AgaP_AGAP011520
DIOPT Version :9
Sequence 1: | NP_649430.1 |
Gene: | BoYb / 40512 |
FlyBaseID: | FBgn0037205 |
Length: | 1059 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_307211.3 |
Gene: | AgaP_AGAP011520 / 1268649 |
VectorBaseID: | AGAP011520 |
Length: | 98 |
Species: | Anopheles gambiae |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 21/58 - (36%) |
Gaps: | 14/58 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 476 GKARNDQHQLCDQILVLGKCYDPVCESRHRLSHIDRRPDYLPASGDVKVQLVKVYSPT 533
|..:..|.||.|.| |..||..:....|.. |.|..|:| |..|.|:
Mosquito 38 GSRKKQQKQLQDAI-------DEYCEQHYLNQSIGH---YEPVFGEV----VAFYDPS 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
BoYb | NP_649430.1 |
P-loop_NTPase |
81..263 |
CDD:304359 |
|
AgaP_AGAP011520 | XP_307211.3 |
TUDOR |
12..>98 |
CDD:278965 |
17/58 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9704 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X13811 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.