DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11131 and CG13033

DIOPT Version :10

Sequence 1:NP_649429.1 Gene:CG11131 / 40511 FlyBaseID:FBgn0037204 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_648902.1 Gene:CG13033 / 39839 FlyBaseID:FBgn0036638 Length:211 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:82/213 - (38%) Gaps:61/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PSSEYLPPVGEAEAAQLSENGYKYRTVRRLKLRHRREVPNQEYLPPVENAPSQEYLPPV------ 87
            ||.:||||| |..||.|:               |..: |.::||||:.|    ||||||      
  Fly    44 PSRDYLPPV-EQHAATLN---------------HVLQ-PPRDYLPPLNN----EYLPPVVEEEQK 87

  Fly    88 -------DAAAIGDTKVADDGYRYKTVRKLKFRARHRRDVSEIAEPSGEYLPPVQVELAPELK-- 143
                   :.....:|..|:     .|...:.......::...|.||..|.......|..||.:  
  Fly    88 QEVPTTTEVIIPEETTTAE-----PTTEAVIITTEQPQEAEIITEPQEEVEVKTVEEEEPEKEVE 147

  Fly   144 -TILGDDGYKYKTVRRLKFRRHRREAVAEEAAAESAPNGEYLPPAEAAAAAPAAAEAEPKSAEEG 207
             .:|.||||.|:|               ........|..|||||.:    ..|..|..|...|:.
  Fly   148 SAVLLDDGYHYRT---------------PSVVPNLLPVKEYLPPLD----GNAVVEELPNGEEDS 193

  Fly   208 TELAKDGYRYKTVRRLRY 225
            :.|..|||.|::|:|||:
  Fly   194 SALLDDGYHYRSVKRLRF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11131NP_649429.1 GYR 47..64 CDD:426962 1/16 (6%)
GYR 99..116 CDD:426962 1/16 (6%)
GYR 212..229 CDD:426962 8/14 (57%)
CG13033NP_648902.1 None

Return to query results.
Submit another query.