DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slif and Slc7a14

DIOPT Version :9

Sequence 1:NP_649428.1 Gene:slif / 40510 FlyBaseID:FBgn0037203 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001128087.1 Gene:Slc7a14 / 499587 RGDID:1594375 Length:412 Species:Rattus norvegicus


Alignment Length:343 Identity:95/343 - (27%)
Similarity:142/343 - (41%) Gaps:112/343 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 LSTVNSYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRYQ------ 413
            |:.|:|||:||::|.||||..|:::::|.:|..|::|||||||||||:|::|||:||||      
  Rat    15 LAHVSSYTETPVVACIVSGFLAALLSLLVSLRDLIEMMSIGTLLAYTLVSVCVLLLRYQPESDID 79

  Fly   414 ------DEEMTK----------------------------------------------------L 420
                  .||.||                                                    .
  Rat    80 GFVKFLSEEHTKKKEGILADCEKETCSPVSEGEEFSSPATNTCGAKNLPSLGDNEMLIGKSDKSA 144

  Fly   421 VSVKAPNV----------------------------------FRQFFNGNSFREPNSMTSSITKV 451
            .:|..||.                                  .|....|...| |.:.|.....:
  Rat   145 YNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPRYYTMRIRLGLPGKMDR-PTAATGHTVTI 208

  Fly   452 GIVVFAIFCLVWCSLQKVFDLDSTGGIV--ALSLVGAVLILICV---VIGMQPVSTIELTFKVPL 511
            .:::..|...::||. .:|..:...|..  |:.||..:|:||.|   ||..||.:..:|.:..|.
  Rat   209 CVLLLFILMFIFCSF-VIFGSEYISGQSWWAILLVVLMLLLITVLVFVILQQPENPKKLPYMAPC 272

  Fly   512 VPFVPCLSVFANLYLMFQLDLNTWIRFLIWIVIGYVIYFCYGMRNSTQISRSRSHAEVAASALQN 576
            :||||..::..|:|||.:|...|||||.:|..:|.:|||.||:.|||....:|..|       .:
  Rat   273 LPFVPAFAMLVNIYLMLKLSTITWIRFAVWCFVGMLIYFGYGIWNSTLEISAREQA-------LH 330

  Fly   577 QGQHVNPGFEPDYKVENG 594
            |..:.....:..:.||.|
  Rat   331 QSTYQRYDVDDPFSVEEG 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slifNP_649428.1 2A0303 8..557 CDD:273330 86/304 (28%)
AA_permease_C 507..557 CDD:290617 22/49 (45%)
Slc7a14NP_001128087.1 AA_permease_C 268..318 CDD:290617 22/49 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1286
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 1 1.010 - - D439017at2759
OrthoFinder 1 1.000 - - FOG0000131
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X81
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.