DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slif and CG1607

DIOPT Version :9

Sequence 1:NP_649428.1 Gene:slif / 40510 FlyBaseID:FBgn0037203 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster


Alignment Length:435 Identity:91/435 - (20%)
Similarity:177/435 - (40%) Gaps:69/435 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GESQLARVLNLFDLTALGVGSTLGLGVYVL-AGQVAFNIAGPAVTISFLIAAIASAFAGICYAEF 82
            ||..|...::|.:...:.|||.:|.|::|. .|.:.:..:.....|.::|:.:.|.....||||.
  Fly    41 GEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAEL 105

  Fly    83 AARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGTASVARGLSGYFDSLINNNMSKALNESM 147
            ...:.|:|:.|.|...|.|.|:||...|   :|.:|     .|..|   .:::      ||..|.
  Fly   106 GTMITKSGADYAYIMETFGPFMAFIRLW---IECMI-----VRPCS---QAIV------ALTFST 153

  Fly   148 HIDVDFLGDYPD---------FLSFGMVLLLAAILAFGAKESSFLNNIFTTVNLVTIAIVLVAGA 203
            ::...|   :|:         .|:...:|:|..|..:..|.::.:.:|||...|:.:.|::..|.
  Fly   154 YVLKPF---FPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGV 215

  Fly   204 MN---ANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGAAKCFY----GFVGFDCIATTGEEAIN 261
            ..   .|...:.....|..                :...|..||    .:.|::.:....||..:
  Fly   216 YQLYLGNTQYFTFENTDTK----------------VTSIALSFYSGLFAYNGWNYLNFIIEELKD 264

  Fly   262 PKRNIPLSIVVSLIIIFLSYFGVS-TVLTMMLPYYKQDKDAP----FPHAFDSVEWYTIKWIVTI 321
            |.:|:|.:|.:|..::.:.|...: :..|::.|.......|.    ...||..:.|       ||
  Fly   265 PVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAW-------TI 322

  Fly   322 GAVFALCT--SLLGAMFPLPRILYAMGKDGILFKRLSTVNSYTKTPLLATIVSGIFASIMAMLFN 384
            ....||.|  ::.|.:....|:.||...:|.:.:.|:.:.....||..|.:...:.:.:...:.:
  Fly   323 PVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSD 387

  Fly   385 LDQLVDMMSIGTLLAYTIVAICVLVLRYQDEEMTKLVSVKAPNVF 429
            :..|::.:...|.|:..:..:|:..||:....:.:  .::.|.||
  Fly   388 IFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPR--PIRVPMVF 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slifNP_649428.1 2A0303 8..557 CDD:273330 91/435 (21%)
AA_permease_C 507..557 CDD:290617
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 90/434 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.