DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:480 Identity:124/480 - (25%)
Similarity:216/480 - (45%) Gaps:74/480 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    91 WVGPWHAIVRIFHPTYIK------P-----VLFAPAAIVP----------KD-------KVFYSF 127
            |....| |..||...|.|      |     ..|...|:|.          ||       .|||:.
  Fly    45 WPNKRH-IAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNE 108

Human   128 LKPWLGDGLLLSAGEKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLASEGSAR 188
            :...|...|....|:||...|..|||.|..    |:....:|:..|...:..:|   .|::....
  Fly   109 IDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSK---TAADRGQV 170

Human   189 LDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYID-FLYYLTP 251
            |::.:.::..|.|.:..|.|..:.:....| :|:::  :...|:...|:..:|   | ||:....
  Fly   171 LEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--IGKRAITEHRYGNML---DIFLFGFPK 230

Human   252 DGQRFRRACRL--VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLL-------LSKD 307
            ..:|.|....:  ..||...:::|.        :|  .:.:.|.|..||:|.|:       ....
  Fly   231 LSRRLRLKLNIQEAEDFYTKIVRET--------ID--YRLRTKEKRNDFMDSLIEMYKNEQSGNS 285

Human   308 EDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEW 372
            |||  |:..::.|:|..|...|.:|:::.:.:.||.||::.:.|::.|:|:..:. .:..||..:
  Fly   286 EDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNKEFTY 347

Human   373 DDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGR-VIPKGIICLISVFGTHHNPAVWPD 436
            :.:.::.:|...:.|:||.:|.:..::|....|....|.: .|.||.|.:|...|.|::|.::|:
  Fly   348 EGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPE 412

Human   437 PEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLL----RFRVLPDHTE 497
            ||::.|.||..:.|..|....::||..|||||||..|.|  |:..:||..|    :|.|.|:...
  Fly   413 PEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGM--MQTCVGLAYLIRGYKFSVSPETQI 475

Human   498 PRR--KPELVLRAEGGLWLRVEPLS 520
            |.:  ...:::.||.|:.|:||.|:
  Fly   476 PMKIVVKNILISAENGIHLKVEKLA 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 120/473 (25%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 117/456 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.