DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp9f2

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster


Alignment Length:425 Identity:96/425 - (22%)
Similarity:180/425 - (42%) Gaps:76/425 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   133 GDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFN----ESVNIMHAKWQLLASEGSAR----- 188
            |..|......:|...|..|:|||..:.::...::.|    |:|:.:        .:..:|     
  Fly   123 GSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCL--------KQDDSRVQENE 179

Human   189 LDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVTKRHQQILLYI--------- 243
            |||.::.:..|.|.:....|... :..:::.:.:.....:|:.....:..:.:|:.         
  Fly   180 LDMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKIL 244

Human   244 ----------DFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDF 298
                      .:...|..|..::|:...:|......::.|.|..:.::        |.|:..:  
  Fly   245 KVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTE--------KTKASAV-- 299

Human   299 IDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLK 363
                        ::.||.||.|:...|.|.|.:|:|..:.:..:.|.::.:.|:|..:|||::.:
  Fly   300 ------------REWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQ 352

Human   364 DREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLP-DGR--VIPKGIICLISVF 425
            |.|.||:.::.:..:.:|...:.|.||..|...||.|.|.:||... ||:  .:.||.:..:...
  Fly   353 DLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTC 417

Human   426 GTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFR 490
            |.|.:|..:.:|..:||.||..:|.:...|..:.||..|.|||||..||:.|.|.|:...|..:|
  Fly   418 GFHRDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYR 482

Human   491 VLPDHTEPRRKP----ELV-----LRAEGGLWLRV 516
            .     .|.:|.    ||:     |..:||.|:::
  Fly   483 F-----APAKKSCIPLELITSGFQLSPKGGFWIKL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 96/422 (23%)
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 95/421 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.