DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp312a1

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_001262008.1 Gene:Cyp312a1 / 40005 FlyBaseID:FBgn0036778 Length:510 Species:Drosophila melanogaster


Alignment Length:551 Identity:167/551 - (30%)
Similarity:260/551 - (47%) Gaps:103/551 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    19 WL---LLLLVGASWLL------ARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGL-------- 66
            ||   ||||..:.:||      :||...|:.          :|.||... |:|||.:        
  Fly     3 WLGFGLLLLALSLYLLYVFERQSRIDRLTHK----------WPAPPALP-FIGHLHILAKLVGPH 56

Human    67 ------------IHSSEEGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVP 119
                        :|.....|                |:|....:|.. :|..|:.:..|...:..
  Fly    57 PLRRATEMINEHLHDHRAKL----------------WMGTKLYLVDC-NPKDIQALCSAQQLLQK 104

Human   120 KDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASE 184
            .:.  |...:.||.:||..|..||||..|:::.|||::.::|.::.:|.:...|:.......|..
  Fly   105 TND--YRVFENWLCEGLFTSGFEKWSHRRKIVMPAFNYTMIKQFVAVFEKQSRILLTNVAKFAES 167

Human   185 GSARLDMFEHISLMTLDSLQKCVF--SFDSHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLY 247
            |. ::|..:.||..|||::.:...  |..|....| |||:.|:..:..::.||.:.|.....|::
  Fly   168 GD-QIDFLQLISCFTLDTICETALGVSVGSQSSAK-SEYLDAVKSILVIIDKRLKNIFYRNSFIF 230

Human   248 YLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQ-AKAKS------------KTLDFI 299
            ..|...:|.:...:.:|.||:.:||:|        :|:..| |:.::            :||.|:
  Fly   231 KRTSHYKREQELIKTLHGFTEGIIQKR--------IDEINQDAENRNYQSSDAELDGVKRTLCFL 287

Human   300 DVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELL-K 363
            |.|||||..|||.|:.:|||.|.||.:|.|.|.||:.|::.:|::..|||:|:|||:||..:. |
  Fly   288 DTLLLSKGPDGKPLTVKDIREEVDTIIFGGFDLTATTLNFFMYNMTLHPEHQQRCREEVWSVCGK 352

Human   364 DR-EPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGT 427
            |: ||..||  .:.||.||..||||:||::|..|..:|..|.:..:.| ..||||...:||....
  Fly   353 DKSEPISIE--QVRQLEFLEACIKETLRMYPSGPLTARKATANCTIND-FFIPKGSDVIISPIYM 414

Human   428 HHNPAVWPDPEVYDPFRF----DPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLR 488
            ......:|||.|:.|.|:    :||    .....||||.||.|:|:||.:||..:|:||...|..
  Fly   415 GRCKDFFPDPMVFKPDRWAIGAEPK----IEATTFIPFMAGARSCMGQRYAMVMLKMVLAHLLRN 475

Human   489 FRVLPDHTEPRRKPELVLRAEGGLWLR-VEP 518
            |..     ||..:.::.|:....:.|. |||
  Fly   476 FLF-----EPLGERQVKLKLNFVITLHTVEP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 152/503 (30%)
Cyp312a1NP_001262008.1 p450 35..505 CDD:278495 156/509 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.