DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F3 and Cyp4d8

DIOPT Version :9

Sequence 1:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:547 Identity:169/547 - (30%)
Similarity:260/547 - (47%) Gaps:107/547 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF 84
            |::||.||.|::                               |||....       .:.:|...
  Fly     6 LVVLLFGAGWII-------------------------------HLGQADR-------RRKVANLP 32

Human    85 GDMCCWWVGPWHAIVRIFHPTYIK--------------PVLFAPAAIVPKDKVF----------- 124
            |.:|...:|....::|:...|:||              ..:|....|:..|...           
  Fly    33 GPICPPLIGAMQLMLRLNPKTFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHL 97

Human   125 -----YSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASE 184
                 |..|..|||:|||||.|:.|.:.|:::||.|||:||:.::::|::..||.   .|.||.:
  Fly    98 VKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNIC---VQRLAQK 159

Human   185 GSAR-LDMFEHISLMTLDSLQKCVFSFDSHCQEKPS-EYIAAILELSALVTKRHQQILLYIDFLY 247
            .:.. .|::..|....||.:.:.......:.|...| .|..|:.|.:||::.|...:.|.::.|:
  Fly   160 ANGNTFDVYRSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLF 224

Human   248 YLTPDGQRFRRA--CRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLD------------- 297
            .||....::|:.  .|.:.:||..||::||:.|..|          :||.:|             
  Fly   225 TLTHPHLKWRQTQLIRTMQEFTIKVIEKRRQALEDQ----------QSKLMDTADEDVGSKRRMA 279

Human   298 FIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELL 362
            .:||||:| ..||:.|::::||.|.|||||||||||.|.||:.|:.|::|||.|.:..:|:.::|
  Fly   280 LLDVLLMS-TVDGRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVL 343

Human   363 KDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDI-----VLPDGRVIPKGIICLI 422
            .....:.:...||.:|.::...||||||::||||.|.|....|.     |..|| |||.|...:|
  Fly   344 GTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDG-VIPAGSEIII 407

Human   423 SVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLL 487
            .:||.|..|..:|:|:.:.|.|.:  |....:|...|||||||||||||.||..|||::|...:.
  Fly   408 GIFGVHRQPETFPNPDEFIPERHE--NGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVR 470

Human   488 RFRVLPDHTEPRRKPELVLRAEGGLWL 514
            .:.:||..........:|||:|.|..|
  Fly   471 EYELLPMGQRVECIVNIVLRSETGFQL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:365848 163/515 (32%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 151/447 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.